DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP71A18

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:515 Identity:130/515 - (25%)
Similarity:208/515 - (40%) Gaps:102/515 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPH----PIYGNMKDWPKKRHIAMIFRDYYT 61
            :||.||.:..|:.|..|:.|..    ::..:|   |.    |:.||:.......|          
plant     7 VSLCLTTLLTLLLLKKFLKRTA----KKVNLP---PSPWRIPVIGNLHQLSLHPH---------- 54

  Fly    62 KYKRSVY-------PFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENR-------GIFYNEIDD 112
               ||::       |....:|......|::..|....:|......|.||       |:.....| 
plant    55 ---RSLHSLSLRYGPLMLLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLMNGGRD- 115

  Fly   113 PLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEE-----MEKIFSAKTTTGEGQVL 172
                .:|...|:.||.::........:.||...|.   ||.||     |||:..|..::....:.
plant   116 ----VVFGPYGEYWRQMKSVCILNLLTNKMVASFE---KVREEEVNAMMEKLEKASCSSSAENLS 173

  Fly   173 EIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGL------LDFLIFGFP- 230
            |   |....|:||...                 |::||:...:...|||      :..|:..|| 
plant   174 E---LFVTLTSDVTSR-----------------VSLGKKYWEDETAGGLKKRVRQIMELLREFPI 218

  Fly   231 --------KLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTE 287
                    .:.|.......:.:|...|:.::...:...|...|.:.||::.|:.: |||:  |..
plant   219 GDYVPALAWIDRINGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSI-EKEK--NNG 280

  Fly   288 DGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIK 352
            ..:..|:|.......|:.|..||||.:.:.:.||..:.:...:|:.||.:.:..|.:....:.::
plant   281 FKVQRNDIKFMILDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKEKEVE 345

  Fly   353 EMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPK---YFIAKGTTVVIPALGIHYDPEIY-PE 413
            .|:||:.|:.|..|.:|.|..:.....|    ||.|   |.||.||.|:|.|..||.||.|: |:
plant   346 NMRYLKAVIKEVFRVHPPLPLILPRLLT----EDVKVKGYDIAAGTEVLINAWSIHRDPAIWGPD 406

  Fly   414 PEKFKPERFTDEAIAAR-PSCTWLPFGEGPRNC--IGLRFGLMQACVGLAYLIRGYKFSV 470
            .|:|||||..|..:... ....::|||.|.|.|  |.|..||::  |.||.|:..:.:||
plant   407 AEEFKPERHLDSTLDYHGQDLKYIPFGSGRRICPGINLAMGLVE--VTLANLVGRFDWSV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 121/480 (25%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 123/496 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.