DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CPD

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:533 Identity:120/533 - (22%)
Similarity:194/533 - (36%) Gaps:122/533 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYT--KYK 64
            :.||.|.::....||.:.|.|   ::|.|:|              |....:.:|...:..  .||
plant     5 AFLLLLSSIAAGFLLLLRRTR---YRRMGLP--------------PGSLGLPLIGETFQLIGAYK 52

  Fly    65 -RSVYPFA-------GFYF---FFTRSAVIT-DLELVKRVLIKDFNHFENRGIFYNEIDDPLSA- 116
             .:..||.       |..|   .|....:.: |.|..:.||       :|.|..: |...|.|. 
plant    53 TENPEPFIDERVARYGSVFMTHLFGEPTIFSADPETNRFVL-------QNEGKLF-ECSYPASIC 109

  Fly   117 ------TLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIV 175
                  :|..::|...:.: |.||.:|.:..       |:|                :..:|:| 
plant   110 NLLGKHSLLLMKGSLHKRM-HSLTMSFANSS-------IIK----------------DHLMLDI- 149

  Fly   176 DLVARYTADVIGN----------CAFGLNCNSLQ--NPNAEFVTIGKRAIIERRYGGLLDFLIFG 228
            |.:.|:..|...:          ..|.|....|.  :|.....::.|..::          :|.|
plant   150 DRLVRFNLDSWSSRVLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYLL----------VIEG 204

  Fly   229 F-----PKLSRRLRLKLNV-QDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTE 287
            |     |..|...|..:.. :.|.:..|.:|....:......|::.|.:.:|:.         .:
plant   205 FFSLPLPLFSTTYRKAIQARRKVAEALTVVVMKRREEEEEGAERKKDMLAALLA---------AD 260

  Fly   288 DGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYE--G 350
            ||.|..||:.......|||:||:||.|..|:..|........||:.|...:.:..::.::.|  .
plant   261 DGFSDEEIVDFLVALLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSD 325

  Fly   351 IKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPE 415
            .|.|.:.:.||.||||...::..:.|...||.  |...|.|.||..|......:|.||..:.:..
plant   326 YKSMPFTQCVVNETLRVANIIGGVFRRAMTDV--EIKGYKIPKGWKVFSSFRAVHLDPNHFKDAR 388

  Fly   416 KFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYK----------FSV 470
            .|.|.|:...::...||..:.|||.|||.|.|.....:...|.|..|:.|:.          |..
plant   389 TFNPWRWQSNSVTTGPSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVPAEQDKLVFFP 453

  Fly   471 STETQIPMKFVVK 483
            :|.||......||
plant   454 TTRTQKRYPIFVK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 110/499 (22%)
CPDNP_196188.1 p450 1..472 CDD:386267 120/533 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.