DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP94D2

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_191222.1 Gene:CYP94D2 / 824830 AraportID:AT3G56630 Length:499 Species:Arabidopsis thaliana


Alignment Length:499 Identity:104/499 - (20%)
Similarity:217/499 - (43%) Gaps:67/499 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 HPIYGNMKDWPKKRHIAMIFRDYYTK------YKRSVYPFAG-FYFFFTRSAVITDLELVKRVLI 94
            :||.|::......||   .|.|:..:      .:.:::...| ..|..|.:..     .|:.:|.
plant    34 YPIVGSLPGLVNNRH---RFLDWTVETLSRCPTQTAIFRRPGKLQFVMTANPA-----NVEYMLK 90

  Fly    95 KDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKN--MFPIIVKVGEEME 157
            ..|..|.....|.:.::|.|...:|:.:|:.|...|...:..|::..:::  |..:.|::...:.
plant    91 TKFESFPKGERFISILEDFLGRGIFNSDGEMWWKQRKTASYEFSTKSLRDFVMSNVTVEINTRLV 155

  Fly   158 KIFSAKTTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVTIGK-----RAIIERR 217
            .:.:...|  .|:::::.|::.|:..|.|...||.::...|.:..|..|...:     ..||.:|
plant   156 PVLAEAAT--NGKLIDLQDILERFAFDNICKLAFNVDSACLGDDGAAGVNFMQAFETAATIISQR 218

  Fly   218 YGGLLDFLIFGFPKLSRRLRLKLNVQD----------VEDFYTSIVRNTIDYRLRTNEKRHDFMD 272
            :..::.:        |.:::.|||:..          |..|...||||.|: :.:.::.:.|.:.
plant   219 FQSVISY--------SWKIKKKLNIGSERVLRESIMIVHKFADEIVRNRIE-QGKVSDHKEDLLS 274

  Fly   273 SLIEMYEKEQAGNTEDGLSFNEILAQAFI-FFVAGFETSSTTMGFALYELALDQDIQDQLRAEIN 336
            ..|   .||:       ::..|||....| |.:||.:|:|:.:.:..:.|::..:::|::..|:|
plant   275 RFI---SKEE-------MNSPEILRDIVISFILAGRDTTSSALSWFFWLLSMHPEVKDKILQELN 329

  Fly   337 NVLSKHNNE----FTYEGIKEMKYLEQVVMETLRKY-PVLAHLTRMTQTDFSPEDPKYFIAKGTT 396
            ::..:....    :.:|.:|.|.||...:.|:||.| ||........:.:..|:..  ||.|...
plant   330 SIRERTGKRIGEVYGFEDLKLMNYLHAAITESLRLYPPVPVDTMSCAEDNVLPDGT--FIGKDWG 392

  Fly   397 VVIPALGIHYDPEIY-PEPEKFKPERFTDE---AIAARPSCTWLPFGEGPRNCIGLRFGLMQACV 457
            :...|..:.....|: .:.::|.|||:.||   .........:..|..|||.|:|.....:|...
plant   393 ISYNAYAMGRMESIWGKDCDRFDPERWIDETNGGFRGENPYKFPAFHAGPRMCLGKEMAYIQMKS 457

  Fly   458 GLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLS 501
            .:|.::..:...|..:.:.|.  ::.|:.|....|::::|::.|
plant   458 IVAAVLERFVVEVPGKKERPE--ILMSVTLRIRGGLNVRVQERS 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 102/491 (21%)
CYP94D2NP_191222.1 p450 52..499 CDD:299894 97/476 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.