DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and AT3G44970

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:519 Identity:128/519 - (24%)
Similarity:220/519 - (42%) Gaps:82/519 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLFMARRRHGYWQ-------RRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDY-------YTKYK 64
            ::|.:||..|.::|       .:..|..:..||.|...|:         |:.|       |.|.|
plant    12 IVLVVARVGHWWYQWSNPKSNGKLPPGSMGFPIIGETLDF---------FKPYGFYEISPYLKKK 67

  Fly    65 RSVY-PFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEID---DPLSA-TLFSIEGQ 124
            ...| |.........::.|.||.::...:|.:     ||:....:..|   .||.. :||...|.
plant    68 MLRYGPLFRTNILGVKTVVSTDKDVNMEILRQ-----ENKSFILSYPDGLMKPLGKDSLFLKIGN 127

  Fly   125 KWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKI----FSAKTTTGEGQVLEIVDLVARYTADV 185
            ..:|::.......:|..:|.      |:.::|:::    .|:|..||.   |::.|.|::.   :
plant   128 IHKHIKQITLHLLSSEGLKR------KILKDMDRVTREHLSSKAKTGR---LDVKDAVSKL---I 180

  Fly   186 IGNCAFGLNCNSLQNPNAEFVTIGKRAIIE--RRYGGLLDFLIFGFPKLSRRL-RLKLNVQDVED 247
            |.:....:..|......|:.:.|.|....:  |     ..:||.....|...| ..:..:::::|
plant   181 IAHLTPKMMSNLKPQTQAKLMGIFKAFTFDWFR-----TSYLISAGKGLYNTLWACREGMREIKD 240

  Fly   248 FYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSST 312
            .||  :|.|      :.||..||:::.||  |.|:||..   |:.|.|:...|.......:|:|.
plant   241 IYT--MRKT------SEEKYDDFLNTAIE--ESEKAGEL---LNENAIITLIFTLSCVTQDTTSK 292

  Fly   313 TMGFALYELALDQDIQDQLRAEINNVL-SKHNNE--FTYEGIK-EMKYLEQVVMETLRKYPVLAH 373
            .:..|:..|..:..:..:|:.|...:| |:.:.|  .|:|..: :|.:...|:.|:||...:...
plant   293 AICLAVKFLLENPKVLAELKKEHEVILESREDKEGGVTWEEYRHKMTFTNMVINESLRITNLAPM 357

  Fly   374 LTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPF 438
            |.|....|.  |...|.|..|..|:|....:|:|||||..|.:|.|.|:..:.:.| .|.|::.|
plant   358 LFRKAVKDV--EIKGYTIPAGWIVMIIPSVVHFDPEIYENPFEFNPWRWEGKELRA-GSKTFMVF 419

  Fly   439 GEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLSK 502
            |.|.|.|.|..|..:|..|.|.:|:..|.||:..:.:     |::.......|||.:.:.|..|
plant   420 GTGLRQCAGAEFARLQISVFLHHLVTTYNFSLHQDCE-----VLRVPAAHLPNGISINISKCPK 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 120/481 (25%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 121/492 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.