DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP94B2

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_566155.1 Gene:CYP94B2 / 821263 AraportID:AT3G01900 Length:496 Species:Arabidopsis thaliana


Alignment Length:516 Identity:112/516 - (21%)
Similarity:206/516 - (39%) Gaps:99/516 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TLIALLVSLLLFMARRRHG-YWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKY-----K 64
            |.|.|||.:||.::..:|. |..|...|.  .:|:.|.:..:...|:..:   |:||:.     .
plant     5 TFILLLVLVLLLVSAGKHVIYSCRNSTPK--TYPVIGCLISFYTNRNRLL---DWYTELLTESPS 64

  Fly    65 RSVY--PFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWR 127
            |:|.  ..|.     .|:.|..:...|:.:|..:|:::.....|...:.|.|...:|:::|..|.
plant    65 RTVVIRRLAA-----RRTVVTANPSNVEYILKTNFDNYPKGKPFTEILGDFLGNGIFNVDGNLWL 124

  Fly   128 HLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSA--KTTTGEGQVLEIVDLVARYTADVIGNCA 190
            ..|...|..||.   |::...:..:..|:||...|  .....:.|..::.:|:.|:|.:::....
plant   125 KQRRLATHDFTP---KSLREYVTVLRNEVEKELLAFLNAAAEDSQPFDLQELLRRFTFNIVCIVF 186

  Fly   191 FGLNCNSLQNPNA-------EFVTIGKRAIIERRYGGLLDFLIFGFPKL-----SRRLRLKLNVQ 243
            .|::..:| ||::       .|.|..  |:...|....|.| ::.|.:|     .:.||..:.. 
plant   187 LGIDRCTL-NPSSPVSEFDRAFQTAS--AVSAGRGSAPLSF-VWKFKRLVGFGSEKELRKAVGE- 246

  Fly   244 DVEDFYTSIVRNTIDYRLRTNEKR---HDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVA 305
                     |.|.:|..:|..:::   .||:..||...|.::.           :........:|
plant   247 ---------VHNCVDEIIRDKKRKPANQDFLSRLIVAGESDET-----------VRDMVISIIMA 291

  Fly   306 GFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPV 370
            |.:|:|.......:.:...::.:..|.:||.:|..:....|.||.:|::..|:..:.|.:|.||.
plant   292 GRDTTSAVATRLFWLITGHEETEHDLVSEIRSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPP 356

  Fly   371 LAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEP-EKFKPERFTDEAIAARPSCT 434
            :...::...||....|.. .:..|..|.....|:....|::.|. ::|||.|:.:.  ..:..|.
plant   357 VPWDSKHALTDDRLPDGT-LVRAGDRVTYFPYGMGRMEELWGEDWDEFKPNRWAES--YDKTCCR 418

  Fly   435 WLP---------FGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSIL 486
            .|.         |..|||.|:|..         :||              :.||::|.|||
plant   419 VLKKVNPFKFPVFQAGPRVCLGEE---------MAY--------------VQMKYIVASIL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 101/485 (21%)
CYP94B2NP_566155.1 CYP86A 65..483 CDD:410687 95/451 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.