DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP72A14

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:442 Identity:124/442 - (28%)
Similarity:209/442 - (47%) Gaps:61/442 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ITDLELVKRVLIKDFNHFENRGIFYNEIDDPLS----ATLFSIEGQKWRHLRHKLTPTFTSGKMK 143
            |.|.|.:|.|..|.:: |:....|      |||    ..|.|.:|.||...|..:.|.|...|:|
plant   108 IMDPEQIKEVFNKVYD-FQKAHTF------PLSKILGTGLVSYDGDKWAQHRRIINPAFHLEKIK 165

  Fly   144 NMFPIIVK-----VGEEMEKIFSAKTTTGEGQVLEIVDL---VARYTADVIGNCAFGLNCN---- 196
            ||..:..:     || |.:|:.|.|.::.|      ||:   :...|||||...|||.:..    
plant   166 NMVHVFHESCSELVG-EWDKLVSDKGSSCE------VDVWPGLTSMTADVISRTAFGSSYREGHR 223

  Fly   197 --SLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGF---PKLSRRLRLKLNVQDVEDFYTSIVRNT 256
              .||   ||...:..:|..:        |.|.|:   |....| |:|...::::|    |:|..
plant   224 IFELQ---AELAQLVMQAFQK--------FFIPGYIYLPTKGNR-RMKTAAREIQD----ILRGI 272

  Fly   257 IDYRLRTNEKRHDFMDSLIEMYEKEQAGNTE-DGLSFNEILAQAFIFFVAGFETSSTTMGFALYE 320
            |:.|.|..|......:.|:.:..:...|.|| :|:|..:::.:..:|::||.||:|..:.:.:..
plant   273 INKRERARESGEAPSEDLLGILLESNLGQTEGNGMSTEDMMEECKLFYLAGQETTSVLLVWTMVL 337

  Fly   321 LALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPE 385
            |:..||.|.:.|.|:..|..  :.:...||:.::|.:..::.|.||.||.:..|||....:....
plant   338 LSQHQDWQARAREEVKQVFG--DKQPDTEGLNQLKVMTMILYEVLRLYPPVVQLTRAIHKEMKLG 400

  Fly   386 DPKYFIAKGTTVVIPALGIHYDPEIY-PEPEKFKPERFTDE-AIAARPSCTWLPFGEGPRNCIGL 448
            |  ..:..|..:.:|.|.:|.|.|:: .:..:||||||.|. :.|.:...::.||..|||.|||.
plant   401 D--LTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFAWGPRICIGQ 463

  Fly   449 RFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL 500
            .|.|::|.:.::.:::.:.|.:| .:.:...:.:  |.|..:.|.||.:.||
plant   464 NFTLLEAKMAMSLILQRFSFELS-PSYVHAPYTI--ITLYPQFGAHLMLHKL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 120/435 (28%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 122/440 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.