DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP72A10

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_188082.2 Gene:CYP72A10 / 820692 AraportID:AT3G14640 Length:536 Species:Arabidopsis thaliana


Alignment Length:522 Identity:128/522 - (24%)
Similarity:230/522 - (44%) Gaps:75/522 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKYKRS--------VYPFA-- 71
            |..:....|.:|:|:......|:.|::     ||::.|:........|.:        .:||.  
plant    52 FKPKMLESYLRRQGLAGTPYTPLIGDL-----KRNVNMLTEATSKPIKLTEDITPRVLPHPFQML 111

  Fly    72 ---GFYFFF----TRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHL 129
               |..||.    ..:..|.|.||:|.|..|.:::.:.:......:   ::..:.:.:|.||...
plant   112 KTHGRTFFTWLGPKPTITIMDPELIKEVFNKVYDYPKAQTFLLGRL---IATGIINYDGDKWAKH 173

  Fly   130 RHKLTPTFTSGKMKNMFPIIVK-----VGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNC 189
            |..:.|.|...|:|||.|...:     |||..:.:....:::.|   :::...:...|.|||...
plant   174 RRIINPAFHIEKIKNMVPAFHQSCSDVVGEWSKLVSDKGSSSCE---VDVWPWLVSMTGDVISRT 235

  Fly   190 AFGLNCNSLQ---NPNAEFVTIGKRA-----IIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVE 246
            |||.:....|   ...||.|.:..:|     |...||          .|..|.| |:|...::::
plant   236 AFGSSYKEGQRIFELQAELVHLILQAFWKVYIPGYRY----------LPTKSNR-RMKAAAREIQ 289

  Fly   247 DFYTSIVRNTIDYRLRTNE-----KRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAG 306
                .|::..::.|||..|     ...|.:..|:|....:..||   |:|..:::.:..:|:.||
plant   290 ----VILKGIVNKRLRAREAGKAAPNDDLLGILLESNLGQAKGN---GMSTEDVMEECKLFYFAG 347

  Fly   307 FETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVL 371
            .||:|..:.:|:..|:..||.|.:.|.|:..|..  :.|...|.:.::|.:..::.|.||.||.:
plant   348 QETTSVLLVWAMVLLSHHQDWQARAREEVKQVFG--DKEPDTECLSQLKVMTMILYEVLRLYPPV 410

  Fly   372 AHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIY-PEPEKFKPERFTDE-AIAARPSCT 434
            .||||....:....|  ..:..|..:.:|.:.:..||.:: .:..:||||||.|. :.|.:...:
plant   411 THLTRAIDKEMKLGD--LTLPAGVHISLPIMLVQRDPMLWGTDAAEFKPERFKDGLSKATKSQVS 473

  Fly   435 WLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVS-TETQIPMKFVVKSILLSAENGIHLKVE 498
            :.||..|||.|||..|.:::|.:.:|.:::.:.|.:| :....|...|.    :..:.|.||.:.
plant   474 FFPFAWGPRICIGQNFAMLEAKMAMALILQTFTFELSPSYVHAPQTVVT----IHPQFGAHLILR 534

  Fly   499 KL 500
            ||
plant   535 KL 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 120/496 (24%)
CYP72A10NP_188082.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.