DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp4f40

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_038935701.1 Gene:Cyp4f40 / 503122 RGDID:1559596 Length:530 Species:Rattus norvegicus


Alignment Length:445 Identity:119/445 - (26%)
Similarity:202/445 - (45%) Gaps:52/445 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 ELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK 151
            ::::.||..........||||:.:...|...|......||...|..|||.|..    |:....||
  Rat   105 DIIRSVLSASAAVAPKDGIFYSFLKPWLGDGLLVSASDKWSRHRSMLTPAFHF----NILKPYVK 165

  Fly   152 VGEEMEKIFSAK---TTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVT--IGKR 211
            :..:...|..||   ..:|....|::.:.::..|.|.:..|.|..|.|..:.| :|::.  :...
  Rat   166 IFNDSTNIMHAKWLRLASGGSAHLDMFENISLMTLDTLQKCVFSFNSNCQEKP-SEYIAAILELS 229

  Fly   212 AIIERRYGGLL---DFLIFGFPKLSRRLRLKLNVQDVEDFYTSIV---RNTID-------YRLRT 263
            |::.:|...||   | |::......||.....::  |.||..:::   |.|:.       .:.:.
  Rat   230 ALVVKRNEQLLLHMD-LLYRLTPDGRRFYKACHL--VHDFTYAVIQERRRTLPKHGGDDVIKAKA 291

  Fly   264 NEKRHDFMDSLIEMYEKEQAGNTEDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQD 326
            ..|..||:|.|:       ....|||  ||..:|.|:|..|...|.:|:::.:.:.||.||...:
  Rat   292 KSKTLDFIDVLL-------LSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLAKHPE 349

  Fly   327 IQDQLRAEINNVLSKHNNE--------FTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFS 383
            .|::.|.|:..:|...::|        ...:.:.::.:|...:.|:||.:|.:..::|....|.|
  Rat   350 YQERCRQEVQELLRDRDSEEIECSCGVLLRDDLAQLPFLTMCIKESLRLHPPVTMVSRCCTQDIS 414

  Fly   384 PEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGL 448
            ..|.: .|.||...:|.....|::|.::.:||.:.|.||..|.|.||....::||..|||||||.
  Rat   415 LPDGR-VIPKGIICIINIFATHHNPTVWQDPEVYDPFRFDPENIQARSPLAFIPFSAGPRNCIGQ 478

  Fly   449 RFGL--MQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKLS 501
            .|.:  |:..|.|..|    :|.|..:.:.|.:  ...::|.||:|:.|:||.||
  Rat   479 TFAMNEMKVAVALTLL----RFRVLPDDKEPRR--KPELILRAEDGLWLRVEPLS 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 114/437 (26%)
Cyp4f40XP_038935701.1 CYP4F 74..522 CDD:410772 114/438 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.