DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP4F3

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:554 Identity:139/554 - (25%)
Similarity:234/554 - (42%) Gaps:112/554 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIALLVSLLLFMAR----------------------RRHGYWQRRGIPHDVPHPI---------Y 40
            |:.|||.....:||                      :|:.:....|:.|.....:         :
Human    20 LLLLLVGASWLLARILAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF 84

  Fly    41 GNMKDW--PKKRHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENR 103
            |:|..|  .....|..||...|.|      |     ..|..:|::.          ||       
Human    85 GDMCCWWVGPWHAIVRIFHPTYIK------P-----VLFAPAAIVP----------KD------- 121

  Fly   104 GIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK--TTT 166
            .:||:.:...|...|....|:||...|..|||.|..    |:....:|:..|...|..||  ...
Human   122 KVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHF----NILKPYMKIFNESVNIMHAKWQLLA 182

  Fly   167 GEGQV-LEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFVT--IGKRAIIERRYGGLL---DFL 225
            .||.. |::.:.::..|.|.:..|.|..:.:..:.| :|::.  :...|::.:|:..:|   |||
Human   183 SEGSARLDMFEHISLMTLDSLQKCVFSFDSHCQEKP-SEYIAAILELSALVTKRHQQILLYIDFL 246

  Fly   226 IFGFP---KLSRRLRLKLNVQDVEDFYTSIV---RNTI------DY-RLRTNEKRHDFMDSLIEM 277
            .:..|   :..|..||      |.||..:::   |.|:      |: :.:...|..||:|.|:  
Human   247 YYLTPDGQRFRRACRL------VHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLL-- 303

  Fly   278 YEKEQAGNTEDG--LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVL- 339
                 ....|||  ||..:|.|:|..|...|.:|:::.:.:.||.||...:.|::.|.|:..:| 
Human   304 -----LSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLK 363

  Fly   340 SKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGI 404
            .:...|..::.:.::.:|...:.|:||.:|.:..::|....|....|.: .|.||...:|...|.
Human   364 DREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGR-VIPKGIICLISVFGT 427

  Fly   405 HYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGL--MQACVGLAYLIRGYK 467
            |::|.::|:||.:.|.||..:.|..|....::||..|||||||..|.:  |:..:||..|    :
Human   428 HHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLL----R 488

  Fly   468 FSVSTETQIPMKFVVKSILLSAENGIHLKVEKLS 501
            |.|..:...|.:  ...::|.||.|:.|:||.||
Human   489 FRVLPDHTEPRR--KPELVLRAEGGLWLRVEPLS 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 125/495 (25%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 128/515 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.