DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:516 Identity:158/516 - (30%)
Similarity:250/516 - (48%) Gaps:44/516 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAM----------IFR 57
            ||:.|:.|.:..|.|..|.::.|::.|||||..|       ..|....::..          :||
  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPP-------SSWSPMGNLGQLLFLRISFGDLFR 59

  Fly    58 DYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEID--DPLSA-TLF 119
            ..|...:.......||:.|.|.:.::.|.||:::||||:||:|.||   :...|  ||:.| ||.
  Fly    60 QLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNR---FESADAGDPMGALTLP 121

  Fly   120 SIEGQKWRHLRHKLTPTFTSGKMKN-MFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTA 183
            ..:...|:..|..::..||||:|:: |:..::.|..::|:..:.|......:||.:..:...||.
  Fly   122 LAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTT 186

  Fly   184 DVIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFL-IFGFPKLSRRLRLKLNVQDVED 247
            ||.||..:.||...|:...:|.:|..|. :.......:|||: :|..||.:..|:.|:..:|   
  Fly   187 DVTGNLFYSLNVGGLRRGRSELITKTKE-LFNTNPRKVLDFMSVFFLPKWTGVLKPKVFTED--- 247

  Fly   248 FYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNE--ILAQAFIFFVAGFETS 310
             |...:|:.:|      :........||...:..|...:.:..|.:.  :.:||.|..:||||||
  Fly   248 -YARYMRHLVD------DHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETS 305

  Fly   311 STTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLT 375
            |..|||.|||||...|||::||:|:...... ....:|:.:..:.||:.|.:|.||.||..|.:.
  Fly   306 SALMGFTLYELAKAPDIQERLRSELREAFIS-TATLSYDTLMTLPYLKMVCLEALRLYPAAAFVN 369

  Fly   376 R----MTQTDFSPEDPKYFIA-KGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTW 435
            |    .....||.:....||. .|....|..||:|.|...:|||..|.||||..|........|:
  Fly   370 RECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTY 434

  Fly   436 LPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLK 496
            :|||.||..|||.|.|::|..:|:.::::.|.......|...::|..||.:|.:||.|:|:
  Fly   435 IPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 144/480 (30%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 140/473 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461080
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
109.900

Return to query results.
Submit another query.