DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:574 Identity:128/574 - (22%)
Similarity:235/574 - (40%) Gaps:143/574 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLTLIALLV------------SLLLFMARRRHGYWQRRGIPHD--VP----HPIYGNMKDWPKK 49
            ||...:|:||            ::|.|.|||   ...:.|.|.|  ||    ..::.|..|...|
  Fly     5 LLWISVAILVVIHWIYKVNKDYNILAFFARR---VQTKDGKPLDSLVPMIKGRTVFANCFDLLGK 66

  Fly    50 ---------RHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNH--FENR 103
                     |.:|....|.|.:|...   |:.|.        :.|......:|    ||  ...:
  Fly    67 DTDQVFTHLRQLAKNSGDSYLQYSMG---FSNFN--------VIDAHNAANIL----NHPNLITK 116

  Fly   104 GIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKT---- 164
            |:.||.:...|...:.:...:||...|..||.||.           :.:..:.::||.|::    
  Fly   117 GVIYNFLHPFLRTGVLTATEKKWHTRRSMLTRTFH-----------LDILNQFQEIFIAESLKFV 170

  Fly   165 TTGEGQ---VLEIVDLVARYTADVIGNCAFGLNCNSLQNP----NAEFVTIGK---RAIIERRYG 219
            :..:||   |:.:.|.::|:|.:.|...|.|:..:.:...    .|.|..|.:   |.|:...|.
  Fly   171 SQFQGQNEVVVSLKDRISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYW 235

  Fly   220 GLLDFLIFGFPKLSRRLRLKLNVQDVEDFYTSIV-------RNTIDYRLRT----------NEKR 267
            ....:.:|...|.:..|::      |.:|...|:       ...::.|..|          .:||
  Fly   236 DDCVYNMFTGHKYNAALKV------VHEFSREIIAKRRVLLEEELENRRATQTADDDICVIRKKR 294

  Fly   268 HDFMDSLIEMYEKEQAGNTED-GLS--FNEILAQAFIFFVAGFETSSTTMGFALYELAL------ 323
            ...:|:|| ..||:  |..:| |:|  .:.::|:       |::|:|..:.|.|..::|      
  Fly   295 FAMLDTLI-CAEKD--GLIDDIGISEEVDTLMAE-------GYDTTSIGLVFGLMNMSLYAAEQE 349

  Fly   324 --DQDIQDQLRAEINNV-LSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPE 385
              .|:||:.:..:::|: ||:         :.::.||...:.||:|.||.:..:.|.|..:...|
  Fly   350 LCYQEIQEHILDDLSNLNLSQ---------LSKLNYLGYFIKETMRLYPSIPIMGRQTLQETELE 405

  Fly   386 DPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRF 450
            : ...:.|.:.:.|....||.:|:.:..||:|:||||..:....|....::||..|.|||||.::
  Fly   406 N-GLILPKRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKY 469

  Fly   451 GLMQACVGLAYLIRGYKF-------SVSTETQIPMKFVVKSILLSAENGIHLKV 497
            .:.:....:..:::.:|.       |:..:..|.::|         :|.|.:|:
  Fly   470 AMQEMKTLMVVILKHFKILPVIDPKSIVFQVGITLRF---------KNKIKVKL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 113/523 (22%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 110/511 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.