DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp4ad1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster


Alignment Length:555 Identity:128/555 - (23%)
Similarity:223/555 - (40%) Gaps:101/555 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLTLIALLVSLLLFMARRRHGYWQRRG-----IPHDVPHPIYGNM-------KDWPKKRHIAMIF 56
            |:.:..:|.::|:|...|...|.....     ||...|:|..||:       .::|||       
  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKK------- 60

  Fly    57 RDYYTKYKRSVYPFAGF--YFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNE-----IDDPL 114
               ..:|.|. |.|.||  ..|.....:::|...::.:|       .:..:.|.|     :...|
  Fly    61 ---VLQYCRK-YDFQGFRSLVFLQYHMMLSDPAEIQNIL-------SSSSLLYKEHLYSFLRPWL 114

  Fly   115 SATLFSIEGQKWRHLRHK--LTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDL 177
            ...|.:..|.:|  |:|:  ..|.|....::....::.:.|.:..:.....:.|.|  |.:..:|
  Fly   115 GDGLLTSSGARW--LKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQE--VFDAQEL 175

  Fly   178 VARYTADVIGNCAFGLNCNSLQNPNAEF---------VTIGKRAIIERRYGGLLDFLIFGFPKLS 233
            ||:.|.|::...|.|.:.:||....::.         |...:...|.:|:..|  |.:..:....
  Fly   176 VAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDAL--FRLTSYYMKQ 238

  Fly   234 RR----LRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDG--LSF 292
            ||    ||.:||....:..:.....||.......|:   .|:|.|:..        ..||  |..
  Fly   239 RRALSLLRSELNRIISQRRHQLAAENTCQQGQPINK---PFLDVLLTA--------KLDGKVLKE 292

  Fly   293 NEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKH-NNEFTYEGIKEMKY 356
            .||:.:...|...|.:..:..:.|.||.|:...:||.:...|...:..:: ..|.....:.:|.|
  Fly   293 REIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHY 357

  Fly   357 LEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPER 421
            ||.::.||||.||.:..:.|..:........|  :||.|||::..:.:.|:.:.:.:|..|:|||
  Fly   358 LELIIRETLRLYPSVPLIARTNRNPIDINGTK--VAKCTTVIMCLIAMGYNEKYFDDPCTFRPER 420

  Fly   422 FTDE----AIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSV------------ 470
            |.:.    .|.|..|   :||..|||.||..:|.:.|....|:.|:|  :|.:            
  Fly   421 FENPTGNVGIEAFKS---VPFSAGPRRCIAEKFAMYQMKALLSQLLR--RFEILPAVDGLPPGIN 480

  Fly   471 --STETQIPMK----FVVKSILLSAENGIHLKVEK 499
              |.|..:|..    .:...:.|.:||||.:::.|
  Fly   481 DHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 119/512 (23%)
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 112/475 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.