DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp6t1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_608457.1 Gene:Cyp6t1 / 33127 FlyBaseID:FBgn0031182 Length:529 Species:Drosophila melanogaster


Alignment Length:522 Identity:178/522 - (34%)
Similarity:265/522 - (50%) Gaps:45/522 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKDWPKKRHIAMI---FRDYYTKYK 64
            ||:..|..|..:|.|.      :|:|.|:|.....|..||:  |...|.....   ||:.|...:
  Fly    29 LLVVTIVWLWQILHFW------HWRRLGVPFVPAAPFVGNV--WNLLRGACCFGDQFRELYESKE 85

  Fly    65 RSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDPL-----SATLFSIEGQ 124
            .:...|.|.......:.::.|..|:||::::||..|.:|    .|..||.     |..||..:.:
  Fly    86 AAGRAFVGIDVLHNHALLLRDPALIKRIMVEDFAQFSSR----FETTDPTCDTMGSQNLFFSKYE 146

  Fly   125 KWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVIGNC 189
            .||.......|.|.:||::||:.::..:|:::|:....|.:..:...||:..|.|.:|.|:|.:.
  Fly   147 TWRETHKIFAPFFAAGKVRNMYGLLENIGQKLEEHMEQKLSGRDSMELEVKQLCALFTTDIIASL 211

  Fly   190 AFGLNCNSLQNPNAEFVTIGKRAIIE---RRYGGLLD-FLIFGFPKLSRRLRLKLNVQDVEDFYT 250
            |||:..:|||||.|||    :|..||   .|...||. |.:|.||:||.|:...|..::.|.|  
  Fly   212 AFGIEAHSLQNPEAEF----RRMCIEVNDPRPKRLLHLFTMFFFPRLSHRVGTHLYSEEYERF-- 270

  Fly   251 SIVRNTIDY----RLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSS 311
              :|.::||    |..:.|.|||.:|..:::...|.|.:......|  ..|||....:|||:|||
  Fly   271 --MRKSMDYVLSQRAESGENRHDLIDIFLQLKRTEPAESIIHRPDF--FAAQAAFLLLAGFDTSS 331

  Fly   312 TTMGFALYELALDQDIQDQLRAEINNVL-SKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLT 375
            :|:.|||||||.:..|||:||.|:...| |..:.:.:.:.:..:.||.|||.|.||.||..|.|.
  Fly   332 STITFALYELAKNTTIQDRLRTELRAALQSSQDRQLSCDTVTGLVYLRQVVDEVLRLYPPTAFLD 396

  Fly   376 R----MTQTDFSPED--PKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCT 434
            |    .|..|.||.:  ..:.:..||.|.|..||||.|.:.:|.||.|.||||:.|........|
  Fly   397 RCCNSRTGYDLSPWNGGSPFKLRAGTPVYISVLGIHRDAQYWPNPEVFDPERFSAEQRQQHHPMT 461

  Fly   435 WLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEK 499
            :||||.|||.|||...|.::..|||.:::..::..|...|...|:|..|:.:|:|.||.:|:..|
  Fly   462 YLPFGAGPRGCIGTLLGQLEIKVGLLHILNHFRVEVCERTLPEMRFDPKAFVLTAHNGTYLRFVK 526

  Fly   500 LS 501
            .|
  Fly   527 NS 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 165/481 (34%)
Cyp6t1NP_608457.1 p450 91..515 CDD:299894 153/437 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461068
Domainoid 1 1.000 151 1.000 Domainoid score I1386
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I1621
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.