DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp28c1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001259464.1 Gene:Cyp28c1 / 32138 FlyBaseID:FBgn0030339 Length:505 Species:Drosophila melanogaster


Alignment Length:524 Identity:140/524 - (26%)
Similarity:242/524 - (46%) Gaps:70/524 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQRRGIPHDVPHPIYGNMKD--WPKKRHIAMIFRDYYTKYK 64
            ||||.:..||.::..|:. ...|:|:|||:......|::|:..:  || ::|..|..||.|..| 
  Fly     4 SLLLGIATLLGAIYAFLV-SNFGHWRRRGVTEPRALPLFGSFPNMIWP-RQHFTMDMRDIYMHY- 65

  Fly    65 RSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEI--------DDPLSATLFSI 121
            |:.:.:.|.|.......::.:..||..:.:..|:||||     |:.        |..::...|.:
  Fly    66 RNTHSYVGCYLLRAPKLLVLEPRLVYEIYVSAFSHFEN-----NDASKMVDIAKDRLVALNPFVL 125

  Fly   122 EGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTADVI 186
            ||::|||.|...:...|:|:::....|:.:|..::.:..:.|:..|:.  |:.:||..|:|.:.:
  Fly   126 EGEEWRHQRAVFSTLLTNGRIRTTHAIMQRVCLDLCQFIAIKSAGGKD--LDCIDLGLRFTGESL 188

  Fly   187 GNCAFGLNCNSL-QNP------NAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQD 244
            .:|..|:...:. .||      |.|.....:...|.....||       ||.|.|.||.|:..:.
  Fly   189 FDCVLGIQARTFTDNPLPVVRQNHEMSAENRGLAIAGAVHGL-------FPNLPRWLRPKVFPRS 246

  Fly   245 VEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFET 309
            .:.||..::...:..|...:::|:||::.|:||       ..|..||..::.:.|..|...|.:|
  Fly   247 HDRFYGQMISEALRLRRSKHQERNDFINHLLEM-------QRELDLSEEDMASHAMTFMFDGLDT 304

  Fly   310 SSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTY----EGIKEMKYLEQVVMETLRKYPV 370
            :|.::...|..|..:.|.|.:|..|:..|     |...|    :.:.::.||.....|:||.||.
  Fly   305 TSNSIAHCLLLLGRNPDCQRRLYEELQLV-----NPGGYLPDLDALIDLPYLSACFNESLRIYPA 364

  Fly   371 LAHLTRMTQTDF----SPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIA-AR 430
            ....::....::    |.......:..|..|::|...:|.||::||||:.|:||||.|..:. .:
  Fly   365 GGWASKTCTKEYELRGSHHSEPLKLRPGDHVMVPIYALHNDPDLYPEPDVFRPERFLDGGLKNCK 429

  Fly   431 PSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTET-----QIPMKFVVKSILLSAE 490
            ....:|.||.|||.|:|:|.||..|...||.:::.::..||..|     ..|:.||         
  Fly   430 QQGIFLGFGNGPRQCVGMRLGLAMAKAALAAIVQRFEVVVSPRTLNGTELDPLIFV--------- 485

  Fly   491 NGIH 494
             |:|
  Fly   486 -GVH 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 128/490 (26%)
Cyp28c1NP_001259464.1 p450 35..487 CDD:299894 126/489 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460924
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.