DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP4A22

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:538 Identity:128/538 - (23%)
Similarity:233/538 - (43%) Gaps:90/538 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQRRGI---PHDVPHPIYGNMKDWPKKRHIAMIFRDYYTKY 63
            |||:.|:.|:.:..|::    |..|..:.:   |....|.::|:::::...:.:..|      :.
Human    23 SLLILLLLLIKAAQLYL----HRQWLLKALQQFPCPPSHWLFGHIQEFQHDQELQRI------QE 77

  Fly    64 KRSVYPFAGFYFFFTRSAVIT--DLELVKRVLIKDFNHFENRGIFYNEIDDPLSATLFSIEGQKW 126
            :...:|.|..|:.:.....:.  |.:.:|.:|.:  :..::.| .|..:...:...|..:.||.|
Human    78 RVKTFPSACPYWIWGGKVRVQLYDPDYMKVILGR--SDPKSHG-SYKFLAPRIGYGLLLLNGQTW 139

  Fly   127 RHLRHKLTPTFTS-------GKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYTAD 184
            ...|..|||.|.:       |.|.:...:::...||:         .|:...||:...|:..|.|
Human   140 FQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEEL---------LGQDSPLEVFQHVSLMTLD 195

  Fly   185 VIGNCAFGLNCNSLQNPNAEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLRLKLNVQDVEDFY 249
            .|...||....:...:.|::...   :||.:      |:.|:|..      :|...:..|.....
Human   196 TIMKSAFSHQGSIQVDRNSQSYI---QAISD------LNSLVFCC------MRNAFHENDTIYSL 245

  Fly   250 TSIVRNT--------------IDYRL----------RTNEKRH-DFMDSLIEMYEKEQAGNTEDG 289
            ||..|.|              |..|.          :...||| ||:|.|:       ....|:|
Human   246 TSAGRWTHRACQLAHQHTDQVIQLRKAQLQKEGELEKIKRKRHLDFLDILL-------LAKMENG 303

  Fly   290 --LSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIK 352
              ||..::.|:...|...|.:|:::.:.:.||.||.....|::.|.||:.:|. .....|:..:.
Human   304 SILSDKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLG-DGASITWNHLD 367

  Fly   353 EMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKF 417
            :|.|....:.|.||.||.:..:.|...|..:..|.: .:.||..|::...|:|::|:::|..|.|
Human   368 QMPYTTMCIKEALRLYPPVPGIGRELSTPVTFPDGR-SLPKGIMVLLSIYGLHHNPKVWPNLEVF 431

  Fly   418 KPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVV 482
            .|.||...  :|:.|..:|||..|.|||||.:|.:.|..|..|..:..::. :...|:||:.  :
Human   432 DPSRFAPG--SAQHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFEL-LPDPTRIPIP--M 491

  Fly   483 KSILLSAENGIHLKVEKL 500
            ..::|.::|||||::.:|
Human   492 ARLVLKSKNGIHLRLRRL 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 116/494 (23%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 118/499 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.