DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp4v3

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001129072.1 Gene:Cyp4v3 / 266761 RGDID:708530 Length:525 Species:Rattus norvegicus


Alignment Length:538 Identity:136/538 - (25%)
Similarity:238/538 - (44%) Gaps:86/538 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQR-RGIPHDV-PHPIYGN---MKDWPKK------------ 49
            ::||.::.:|||    .||:    ||: |.||... .:|:.|:   ||  |..            
  Rat    28 TVLLNILQMLVS----YARK----WQQMRPIPSVARAYPLVGHALFMK--PNNTEFFQQIIQYTE 82

  Fly    50 --RHIAMIFRDYYTKYKRSVYPFAGFYFFFTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDD 112
              ||:.:|      |......|....|.......::|..:.:            ::...|..:..
  Rat    83 EFRHLPII------KLWIGPVPLVALYKAENVEVILTSSKQI------------DKSFMYKFLQP 129

  Fly   113 PLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQ-VLEIVD 176
            .|...|.:..|.|||..|..|||:|....:::...::    .|...|...|......| ......
  Rat   130 WLGLGLLTSTGSKWRARRKMLTPSFHFTILEDFLDVM----NEQANILVNKLEKHVNQEAFNCFF 190

  Fly   177 LVARYTADVIGNCAFGLNCNSLQNPNAEFV-TIGKRA-IIERR-----YGGLLDFLIFGFPKLSR 234
            .:.....|:|...|.|.|..:..|.::|:| |:.:.: :|.||     :...|.:|:|   |..|
  Rat   191 PITLCALDIICETAMGKNIGAQSNGDSEYVRTVYRMSDMIYRRMKMPWFWFDLWYLMF---KEGR 252

  Fly   235 RLRLKLNVQDVEDFYTSIVRNTIDYR-------------LRTNEKRHDFMDSLIEMYEKEQAGNT 286
              ..|..::.:..|..:::...::.|             |.:..||..|:|.|:.:.::|  ||.
  Rat   253 --DHKKGLKSLHTFTNNVIAERVNARKAEQDCIGAGRGPLPSKTKRKAFLDLLLSVTDEE--GNK 313

  Fly   287 EDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGI 351
               ||..:|..:...|...|.:|::..:.::||.|..:.::|.::..|:::|..:.:...|.|.:
  Rat   314 ---LSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQRKVDKELDDVFGRSHRPVTLEDL 375

  Fly   352 KEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEK 416
            |::|||:.|:.||||.:|.:....|....|.  |...|.|:|||..||....:|.||..:|:||:
  Rat   376 KKLKYLDCVIKETLRVFPSVPLFARSLSEDC--EVAGYKISKGTEAVIIPYALHRDPRYFPDPEE 438

  Fly   417 FKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFV 481
            |:||||..|....|....::||..|||||||.:|.:|:....||.::|  :|.:.:..:.....:
  Rat   439 FQPERFFPENSQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILACILR--EFWIESNQKREELGL 501

  Fly   482 VKSILLSAENGIHLKVEK 499
            ...::|...|||.:|:::
  Rat   502 AGDLILRPNNGIWIKLKR 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 123/496 (25%)
Cyp4v3NP_001129072.1 CYP4V 76..515 CDD:410773 118/474 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.