DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_058781.2 Gene:Cyp19a1 / 25147 RGDID:2457 Length:503 Species:Rattus norvegicus


Alignment Length:374 Identity:78/374 - (20%)
Similarity:154/374 - (41%) Gaps:63/374 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK-VGEEMEKIFSAKTTTGEGQVLEIVDLVARY 181
            :|:.....||.:|.......|...:..|..:.|: :.:.::::  ...|...|.| ::|.|:...
  Rat   133 IFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRL--GDVTDNSGYV-DVVTLMRHI 194

  Fly   182 TADVIGNCAFGLNCNS-----------------LQNPNAEFVTIGKRAIIERRYGGLLDFLIFGF 229
            ..|.......|:..:.                 |..||..|    |.:.:.|:|           
  Rat   195 MLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFF----KISWLYRKY----------- 244

  Fly   230 PKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRLRTNEKRHDFMDSLIEMYEKEQAGN-TEDGLSFN 293
                     :.:|:|::|....:|... ..::.:.||..|.||...::...|:.|: |::.:  |
  Rat   245 ---------ERSVKDLKDEIEILVEKK-RQKVSSAEKLEDCMDFATDLIFAERRGDLTKENV--N 297

  Fly   294 EILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLE 358
            :.:.:   ..:|..:|.|.|:...|..:|...:::..:..||:.|:.  :.:.....::.:|.:|
  Rat   298 QCILE---MLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVG--DRDIRIGDVQNLKVVE 357

  Fly   359 QVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFT 423
            ..:.|:||..||:..:.|....|...:.  |.:.|||.::: .:|..:..|.:|:|.:|..|.|.
  Rat   358 NFINESLRYQPVVDLVMRRALEDDVIDG--YPVKKGTNIIL-NIGRMHRLEYFPKPNEFTLENFE 419

  Fly   424 DEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVST 472
            ...    |...:.|||.|||:|.|....::...|.|..|::  :|.|.|
  Rat   420 KNV----PYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLK--RFHVKT 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 78/374 (21%)
Cyp19a1NP_058781.2 CYP19A1 72..485 CDD:410709 78/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.