DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and Cyp4a2

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus


Alignment Length:564 Identity:134/564 - (23%)
Similarity:233/564 - (41%) Gaps:134/564 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLLTLIALLVSLLLFMARRRHGYWQRRGI---PHDVPHPIYG-NMKD--------WPKKRHIAM 54
            :.||:|..:|...:.|..||:   |..:.:   |....|.::| |:||        |.:|     
  Rat    22 AFLLSLFLVLFKAVQFYLRRQ---WLLKALEKFPSTPSHWLWGHNLKDREFQQVLTWVEK----- 78

  Fly    55 IFRDYYTKYKRSVYPFAGFYFF--FTRSAVITDLELVKRVLIKDFNHFENRGIFYNEIDDP---- 113
                         :|.|...:.  .|...::.|.:.||.||.:               .||    
  Rat    79 -------------FPGACLQWLSGSTARVLLYDPDYVKVVLGR---------------SDPKPYQ 115

  Fly   114 -----LSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVK----VGEEMEKIFSAKTTTGEG 169
                 :...|..:.|:||...|..|||.|....:|....|:..    :.::.||:      ..:.
  Rat   116 SLAPWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKL------DDQD 174

  Fly   170 QVLEIVDLVARYTADVIGNCAFG------LNCNSLQNPNA-----EFVTIGKRAIIERRYGGLLD 223
            ..|||...|:..|.|.:..|||.      |:.||.....|     ..:....|:..   ||..:.
  Rat   175 HPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLIFFRVRSAF---YGNSII 236

  Fly   224 FLIFGFPKLSRR------------------LRL--------KLNVQDVEDFYTSIVRNTIDYRLR 262
            :.:....:||||                  |.|        |..:|:.|:..            :
  Rat   237 YNMSSDGRLSRRACQIAHEHTGSVFLLPAFLSLSDGVIKTRKAQLQNEEELQ------------K 289

  Fly   263 TNEKRH-DFMDSLIEMYEKEQAGNTEDGLSFNEILAQAFIFFVAGFETSSTTMGFALYELALDQD 326
            ..:||| ||:|.|  ::.|.:.|.:   ||..::.|:...|...|.:|:::.:.:..|.||...:
  Rat   290 ARKKRHLDFLDIL--LFAKMEDGKS---LSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPE 349

  Fly   327 IQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFI 391
            .|::.|.|:.::|. .....|::.:.:|.|....:.|.||.|..:..::|...:..:..|.: .|
  Rat   350 HQERCREEVQSILG-DGTSVTWDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGR-SI 412

  Fly   392 AKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEAIAARPSCTWLPFGEGPRNCIGLRFGLMQAC 456
            .||..|.|...|:|::|..:|.|:.|.|.||:.:  :.|.|..:|||..|.|||||.:|.:.:..
  Rat   413 PKGIRVTILIYGLHHNPSYWPNPKVFDPSRFSPD--SPRHSHAYLPFSGGARNCIGKQFAMNELK 475

  Fly   457 VGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAENGIHLKVEKL 500
            |.:|..:..::. :...|:||:.  :..::|.::|||||:::||
  Rat   476 VAVALTLLRFEL-LPDPTRIPVP--MPRLVLKSKNGIHLRLKKL 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 121/520 (23%)
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 117/508 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.