DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and CYP4B1

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001093242.1 Gene:CYP4B1 / 1580 HGNCID:2644 Length:512 Species:Homo sapiens


Alignment Length:402 Identity:100/402 - (24%)
Similarity:179/402 - (44%) Gaps:40/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK--TTTGEGQVLEIVDLVAR 180
            |..:||.||...|..|||.|....:|.    .|.|..|..:|...|  ....||:..:|...|..
Human   126 LLVLEGPKWLQHRKLLTPGFHYDVLKP----YVAVFTESTRIMLDKWEEKAREGKSFDIFCDVGH 186

  Fly   181 YTADVIGNCAFGLNCNSLQNPN--------AEFVTIGKRAIIERRYGGLLDFLIFGFPKLSRRLR 237
            ...:.:..|.||.....|.:..        ::...:.::.::..:|..  ||:.:..|...|.||
Human   187 MALNTLMKCTFGRGDTGLGHSRDSSYYLAVSDLTLLMQQRLVSFQYHN--DFIYWLTPHGRRFLR 249

  Fly   238 LKLNVQDVEDFYTSIVR------NTIDYRLRTNEKRH-DFMDSLIEMYEKEQAGNTEDG--LSFN 293
            .   .|...|....::|      .....|.:...:|| ||:|.|:       ....||.  ||..
Human   250 A---CQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILL-------GARDEDDIKLSDA 304

  Fly   294 EILAQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLE 358
            ::.|:...|...|.:|:::.:.:.||.:||..:.|.:.|.|:..:|. ..:.|.::.:.:|.||.
Human   305 DLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILG-DQDFFQWDDLGKMTYLT 368

  Fly   359 QVVMETLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFT 423
            ..:.|:.|.||.:..:.|......:..|.:...| |:.:.:....:|.:..::|:||.|...||:
Human   369 MCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPA-GSLISMHIYALHRNSAVWPDPEVFDSLRFS 432

  Fly   424 DEAIAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLS 488
            .|..:.|....::||..|||||||.:|.:.:..|..|..:..::||:. .:::|:|  :..::|.
Human   433 TENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLD-PSRLPIK--MPQLVLR 494

  Fly   489 AENGIHLKVEKL 500
            ::||.||.::.|
Human   495 SKNGFHLHLKPL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 97/395 (25%)
CYP4B1NP_001093242.1 p450 47..501 CDD:306555 97/395 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.