Sequence 1: | NP_611000.2 | Gene: | Cyp6a23 / 36661 | FlyBaseID: | FBgn0033978 | Length: | 502 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343697.1 | Gene: | cyp-31A5 / 13198891 | WormBaseID: | WBGene00013381 | Length: | 308 | Species: | Caenorhabditis elegans |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 76/204 - (37%) | Gaps: | 58/204 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 NRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK--- 163
Fly 164 --TTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFV----TIGKRAIIERRYGGLL 222
Fly 223 DFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRL----RTNEK----RHDFMDSLIEMYE 279
Fly 280 KEQAGNTED 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cyp6a23 | NP_611000.2 | p450 | 36..495 | CDD:278495 | 49/204 (24%) |
cyp-31A5 | NP_001343697.1 | p450 | 36..>261 | CDD:325183 | 48/200 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1247045at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100014 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |