DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6a23 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:204 Identity:49/204 - (24%)
Similarity:76/204 - (37%) Gaps:58/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NRGIFYNEIDDPLSATLFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAK--- 163
            |:|..|..::..|..::.:.:.::||..|..|||||....:|:..||.    .|..||...|   
 Worm   101 NKGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIF----NEQSKILIQKLCC 161

  Fly   164 --TTTGEGQVLEIVDLVARYTADVIGNCAFGLNCNSLQNPNAEFV----TIGKRAIIERRYGGLL 222
              ....|..||.::.|.   |.|:|...:.|....:....|.|:|    ||.|  :|.:|..   
 Worm   162 LGVADEEVDVLSVITLC---TLDIICETSMGKAIGAQLAENNEYVWAVHTINK--LISKRTN--- 218

  Fly   223 DFLIFGFPKLSRRLRLKLNVQDVEDFYTSIVRNTIDYRL----RTNEK----RHDFMDSLIEMYE 279
                                       ..::.|:..|.|    ||:||    .|||...:|  .|
 Worm   219 ---------------------------NPLMWNSFIYNLTEDGRTHEKCLHILHDFTKKVI--VE 254

  Fly   280 KEQAGNTED 288
            :::|....|
 Worm   255 RKEALQDSD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 49/204 (24%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 48/200 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.