DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ferd3l and Fer1

DIOPT Version :9

Sequence 1:NP_001102450.1 Gene:Ferd3l / 366598 RGDID:1311812 Length:166 Species:Rattus norvegicus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:78 Identity:38/78 - (48%)
Similarity:60/78 - (76%) Gaps:4/78 - (5%)


- Green bases have known domain annotations that are detailed below.


  Rat    91 RPKRKRVITY--AQRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFM 153
            :|:|.:..:.  .||||||:|||:||.::||||:.||..:||..||||||:::||:|||.||:|:
  Fly    74 KPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFL 138

  Rat   154 TELLQSKEEKEAS 166
            :|::  |::|..:
  Fly   139 SEMV--KKDKNGN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ferd3lNP_001102450.1 HLH 102..154 CDD:278439 33/51 (65%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 29/53 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.