DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Colec11 and lectin-22C

DIOPT Version :9

Sequence 1:XP_006240022.1 Gene:Colec11 / 366588 RGDID:1309678 Length:277 Species:Rattus norvegicus
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:157 Identity:48/157 - (30%)
Similarity:79/157 - (50%) Gaps:16/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Rat   122 IGEMDNQVTQLTTEIKFIKNALPSPAAVAGVRETESKIYLLVK-EEKRYADAQLSCQGRGGTLSM 185
            :..::..|.::.|:||::           |..:..||.|.:.| .||.::.|..:|:..||.|:.
  Fly   120 LSALEKTVLEVKTKIKYL-----------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLAD 173

  Rat   186 PKDEAANGLMASYLAQAGLARVFIGINDLEREGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVE 250
            .||||....:.:.|.:.  ...::|||||:.||.|:........||.||.||.|:. .|..:|| 
  Fly   174 IKDEADLAAIKANLKED--THYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRPSQ-LDTLNCV- 234

  Rat   251 MVASGGWNDVACHITMYFMCEFDKENL 277
            .:.:|...|..||.|..|:|:.::|:|
  Fly   235 FLYNGEMYDYPCHYTFRFICQTEEEDL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Colec11XP_006240022.1 Collagen 40..95 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 41/115 (36%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 38/112 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10071
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45908
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.