DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcf11 and AT1G66500

DIOPT Version :9

Sequence 1:NP_610999.4 Gene:Pcf11 / 36658 FlyBaseID:FBgn0264962 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_176823.1 Gene:AT1G66500 / 842968 AraportID:AT1G66500 Length:416 Species:Arabidopsis thaliana


Alignment Length:310 Identity:70/310 - (22%)
Similarity:117/310 - (37%) Gaps:73/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1231 KTDAPAEPPKPPPIIVKPPPV--VEQPKPAPVAVAPISLPAAAAALESLNINDLFQKLVSSGIIG 1293
            :|..|..|.:....:...|..  |:.|......|:.:|.......:.|..:.||.      .::.
plant   151 RTLTPNYPVRSSNFVPNTPVFTNVQNPMNHSNMVSVVSQSMHQPIVLSKELTDLL------SLLN 209

  Fly  1294 GATAAPTLPAADSSAAKEPTASATEPSTASATVAPATLPAGPPAEPIKRIDLRKPESIKTRQAAV 1358
            ......||.|::|.                      :||.|        :....|.|:..|..:|
plant   210 NEKEKKTLEASNSD----------------------SLPVG--------LSFDNPSSLNVRHESV 244

  Fly  1359 VAVLYLGM--QCSSCGVRFPPEQTIKYSQHLDWHFRQNRRERDSTR----KATSRKWYYDLNDWR 1417
            :..||..|  ||||||:||..::  ::|:|:|||.|:||..:.:||    ...||.|....:.| 
plant   245 IKSLYSDMPRQCSSCGLRFKCQE--EHSKHMDWHVRKNRSVKTTTRLGQQPKKSRGWLASASLW- 306

  Fly  1418 QYEEIEDVEEREKNFLEAQGQPGG--VEALD---ELSQQRSLDSPVPTCAAGRDDVDHCCDMCHE 1477
                             .....||  ||...   |:.:::..|..........|:....|.:|.|
plant   307 -----------------LCAATGGETVEVASFGGEMQKKKGKDEEPKQLMVPADEDQKNCALCVE 354

  Fly  1478 KFEQFYNEELEEWHLRSAIRV--EDKIYHPLCYEDYKAS--LNPPTEVKS 1523
            .||:|::.|.::|..:.|:.:  ..:|.|..|..:.:.:  |..|:.|.|
plant   355 PFEEFFSHEDDDWMYKDAVYLTKNGRIVHVKCMPEPRPAKDLREPSRVMS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcf11NP_610999.4 CID 17..134 CDD:239621
Siah-Interact_N 187..255 CDD:286164
Stathmin 736..>839 CDD:279209
AT1G66500NP_176823.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D321518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3055
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15921
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.