DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcf11 and AT5G43620

DIOPT Version :9

Sequence 1:NP_610999.4 Gene:Pcf11 / 36658 FlyBaseID:FBgn0264962 Length:1953 Species:Drosophila melanogaster
Sequence 2:NP_199175.1 Gene:AT5G43620 / 834382 AraportID:AT5G43620 Length:410 Species:Arabidopsis thaliana


Alignment Length:208 Identity:56/208 - (26%)
Similarity:90/208 - (43%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1330 TLPAGPPAEPIKRIDLRKPESIKTRQAAVVAVLYLGM--QCSSCGVRFPPEQTIKYSQHLDWHFR 1392
            :||.|        :....|.|:..|..:|:..||..|  ||:||||||..::  ::|:|:|||.|
plant   217 SLPVG--------LSFDNPSSLNVRHESVIKSLYSDMPRQCTSCGVRFKCQE--EHSKHMDWHVR 271

  Fly  1393 QNRRERDSTR----KATSRKWYYDLNDWRQYEEIEDVEEREKNFLEAQGQPGGVEALD----ELS 1449
            :||..:.:||    ...||.|....:.|                |.|....|.||...    |:.
plant   272 KNRSVKTTTRLGQQPKKSRGWLASASLW----------------LCAPTGGGTVEVASFGGGEMQ 320

  Fly  1450 QQRSLDSPVPTCAAGRDDVDHCCDMCHEKFEQFYNEELEEWHLRSAIRV--EDKIYHPLCYEDYK 1512
            ::...|..........|:....|.:|.|.||:|::.|.::|..:.|:.:  ..:|.|..|..:.:
plant   321 KKNEKDQVQKQHMVPADEDQKNCALCVEPFEEFFSHEADDWMYKDAVYLTKNGRIVHVKCMPEPR 385

  Fly  1513 AS--LNPPTEVKS 1523
            .:  |..|:.|.|
plant   386 PAKDLREPSRVMS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcf11NP_610999.4 CID 17..134 CDD:239621
Siah-Interact_N 187..255 CDD:286164
Stathmin 736..>839 CDD:279209
AT5G43620NP_199175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3055
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.