DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ercc1 and FAAP24

DIOPT Version :9

Sequence 1:NP_477468.1 Gene:Ercc1 / 36654 FlyBaseID:FBgn0028434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_689479.1 Gene:FAAP24 / 91442 HGNCID:28467 Length:215 Species:Homo sapiens


Alignment Length:215 Identity:52/215 - (24%)
Similarity:91/215 - (42%) Gaps:41/215 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VLVHSKQRGNPILKSIL-NVPLEFRDDIVPDYVVGRTSCVLYLSLKYHNLNPDYICQRLKALGKM 126
            ::.:.|.||:.:.:.:. .:.|.|.|.:.||:.:....|:||::      ..|.:.      |..
Human    19 IVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVT------EADLVA------GNG 71

  Fly   127 YELRVLLVQVDTPEPNNALKSL-----TRIS----------LLADLTMML---AWNAEEAGKIIE 173
            |..|::.|:     .:|.||.:     ||:|          .:.||.|:|   |...|.:..:|:
Human    72 YRKRLVRVR-----NSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQ 131

  Fly   174 TYKQFEKRP---PDLIMERVESNPHQKLLAALTNIKPVNKTDAAALLHTFGNLGNIINASEERLS 235
            ..::..|.|   |.|..:|........||..:..|..|.|..|..||..|.::..:.|||...|.
Human   132 LVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELE 196

  Fly   236 QVMGLGPRKAKKLYKTLQEP 255
            ||  :|...|::::....:|
Human   197 QV--VGQAVAQQIHAFFTQP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ercc1NP_477468.1 RAD10 1..257 CDD:227566 52/215 (24%)
DUF1556 <26..70 CDD:284914 1/6 (17%)
Rad10 62..176 CDD:281785 29/131 (22%)
HHH_5 202..254 CDD:291205 15/51 (29%)
FAAP24NP_689479.1 PND 11..134 CDD:375443 29/131 (22%)
RuvA domain 2-like 160..215 17/57 (30%)
HHH_2 166..215 CDD:372333 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.