DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ercc1 and ERCC1

DIOPT Version :9

Sequence 1:NP_477468.1 Gene:Ercc1 / 36654 FlyBaseID:FBgn0028434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001356337.1 Gene:ERCC1 / 2067 HGNCID:3433 Length:323 Species:Homo sapiens


Alignment Length:247 Identity:113/247 - (45%)
Similarity:161/247 - (65%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PKVDAPAATAVNPAP--------------SNSTEPSGSGRPAPG-------KPASNPHCVLVHSK 68
            |.||    |:...||              :.:|.|:|| .|..|       ||.:..:.::|..:
Human    47 PTVD----TSAQAAPQTYAEYAISQPLEGAGATCPTGS-EPLAGETPNQALKPGAKSNSIIVSPR 106

  Fly    69 QRGNPILKSILNVPLEFRDDIVPDYVVGRTSCVLYLSLKYHNLNPDYICQRLKALGKMYELRVLL 133
            |||||:||.:.|||.|| .|::||||:|:::|.|:|||:||||:||||..||::|||.:.|||||
Human   107 QRGNPVLKFVRNVPWEF-GDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLL 170

  Fly   134 VQVDTPEPNNALKSLTRISLLADLTMMLAWNAEEAGKIIETYKQFEKRPPDLIMERVESNPHQKL 198
            ||||..:|..|||.|.::.:|||.|::|||:.||||:.:||||.:|::|.||:||::|.:...::
Human   171 VQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRV 235

  Fly   199 LAALTNIKPVNKTDAAALLHTFGNLGNIINASEERLSQVMGLGPRKAKKLYK 250
            ...||.:|.|||||:..||.|||:|..:|.||.|.|:...||||:|.:.|.|
Human   236 TECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKVRALGK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ercc1NP_477468.1 RAD10 1..257 CDD:227566 113/247 (46%)
DUF1556 <26..70 CDD:284914 14/64 (22%)
Rad10 62..176 CDD:281785 64/113 (57%)
HHH_5 202..254 CDD:291205 26/49 (53%)
ERCC1NP_001356337.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
Nuclear localization signal. /evidence=ECO:0000255 17..23
Rad10 100..213 CDD:309095 64/113 (57%)
PRK00024 <250..>281 CDD:178801 15/30 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149699
Domainoid 1 1.000 144 1.000 Domainoid score I4638
eggNOG 1 0.900 - - E1_COG5241
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1501
Inparanoid 1 1.050 227 1.000 Inparanoid score I3493
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56876
OrthoDB 1 1.010 - - D1336192at2759
OrthoFinder 1 1.000 - - FOG0005138
OrthoInspector 1 1.000 - - oto89236
orthoMCL 1 0.900 - - OOG6_102832
Panther 1 1.100 - - LDO PTHR12749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1423
SonicParanoid 1 1.000 - - X4160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.