DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ercc1 and ercc-1

DIOPT Version :9

Sequence 1:NP_477468.1 Gene:Ercc1 / 36654 FlyBaseID:FBgn0028434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001369985.1 Gene:ercc-1 / 172867 WormBaseID:WBGene00008665 Length:262 Species:Caenorhabditis elegans


Alignment Length:232 Identity:76/232 - (32%)
Similarity:109/232 - (46%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PAPSNSTEP----SGSGRPAPGKPASNPHCVLVHSKQRGNPILKSILNVPLEFRDDIVPDYVVGR 97
            |:.|.|::|    .|||.           .|:...:|.|||:||.:.||..|: .||.||:..|.
 Worm    33 PSSSTSSDPPVGIGGSGA-----------LVVNRRRQEGNPVLKYVRNVRYEW-GDIGPDFECGP 85

  Fly    98 TSCVLYLSLKYHNLNPDYICQRLKALGK-MYELRVLLVQVDTPEPNNALKSLTRISLLADLTMML 161
            |..|:|||.|||..:|:|:..|:....: .|..:|||...:..||.:.|:.|..|......|.::
 Worm    86 TFGVVYLSFKYHKQHPEYVYTRINGNAENRYRNKVLLGYCNMEEPRHVLRELNMICFREAWTFVV 150

  Fly   162 AWNAEEAGKIIETYKQFEKRP-----------PDLIMERVESNPHQKLLAALTNIKPVNKTDAAA 215
            .:..|||.:.||.:|..:|:.           .|..|........:..:..||..:.:.||||..
 Worm   151 VYTVEEAAEYIELFKTTQKKEITIKKKAIDDGGDSSMSDERRRNREAAIGFLTAARSITKTDADR 215

  Fly   216 LLHTFGNLGNIINASEERLSQVMGLGPRKAKKLYKTL 252
            ||..||.|..|..|||..:|...|:||.|||.|:..|
 Worm   216 LLFHFGTLQAISTASETSISACPGVGPIKAKNLHSFL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ercc1NP_477468.1 RAD10 1..257 CDD:227566 76/232 (33%)
DUF1556 <26..70 CDD:284914 8/36 (22%)
Rad10 62..176 CDD:281785 41/114 (36%)
HHH_5 202..254 CDD:291205 24/51 (47%)
ercc-1NP_001369985.1 Rad10 50..165 CDD:397767 41/126 (33%)
uvrC <184..252 CDD:237782 25/67 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161117
Domainoid 1 1.000 73 1.000 Domainoid score I6045
eggNOG 1 0.900 - - E1_COG5241
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I3521
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56876
OrthoDB 1 1.010 - - D1336192at2759
OrthoFinder 1 1.000 - - FOG0005138
OrthoInspector 1 1.000 - - oto20547
orthoMCL 1 0.900 - - OOG6_102832
Panther 1 1.100 - - LDO PTHR12749
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1423
SonicParanoid 1 1.000 - - X4160
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.