DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ercc1 and Faap24

DIOPT Version :9

Sequence 1:NP_477468.1 Gene:Ercc1 / 36654 FlyBaseID:FBgn0028434 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_848758.1 Gene:Faap24 / 101831 MGIID:2142208 Length:221 Species:Mus musculus


Alignment Length:232 Identity:52/232 - (22%)
Similarity:95/232 - (40%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PSGSGRPAPGKPASNP--HCVLVHSKQRGNPILKSIL-NVPLEFRDDIV-PDYVVGRTSCVLYLS 105
            |.|:|      |...|  | ::...|.||:.:.:.:. .|.|.|.:.:. .|:.:...||:||::
Mouse     6 PDGTG------PVHVPLGH-IVASEKWRGSQLAQEMQGKVRLIFEEGLASADFYLSSKSCILYVT 63

  Fly   106 LKYHNLNPDYIC-----QRLKALGKMYELRVLLVQVDTPEPNNALKSLTRISLLADLTMML--AW 163
                  ..|.:.     :||........|:.:::...|........::.:.::| ||.|:|  ..
Mouse    64 ------EADLVAGHGYRKRLARFRNSSHLQGIIIVEKTQMSEQYFPAVQKFTVL-DLGMVLLPVA 121

  Fly   164 NAEEAGKIIETYKQFEKRPPDLIMERVESNPHQK----------LLAALTNIKPVNKTDAAALLH 218
            :..||..:|....|.:.|.|       ..||..:          |:..:..|..|.|..|..||.
Mouse   122 SQSEASCLIIHLVQEQTREP-------SKNPFLRKKRSMLSELSLVQTVQQIPGVGKVKAPLLLQ 179

  Fly   219 TFGNLGNIINASEERLSQVMGLGPRKAKKLYKTLQEP 255
            .|.::..:.|||.:.|.:|  :||..|::::....:|
Mouse   180 KFPSIQQLSNASVQELEEV--VGPAAAQQIHTFFTQP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ercc1NP_477468.1 RAD10 1..257 CDD:227566 52/232 (22%)
DUF1556 <26..70 CDD:284914 7/26 (27%)
Rad10 62..176 CDD:281785 24/122 (20%)
HHH_5 202..254 CDD:291205 15/51 (29%)
Faap24NP_848758.1 HHH_2 166..218 CDD:289587 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.