DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC2 and AT3G28925

DIOPT Version :9

Sequence 1:NP_610995.1 Gene:SMC2 / 36653 FlyBaseID:FBgn0027783 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_683601.1 Gene:AT3G28925 / 822528 AraportID:AT3G28925 Length:247 Species:Arabidopsis thaliana


Alignment Length:231 Identity:48/231 - (20%)
Similarity:87/231 - (37%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   804 EKSRANWKKREQEFETLQLEITELQKSIETAKKQHQEMIDNLEKFKAELDALKVNSSSAASEVTE 868
            |....|.||.::.    ..|:.||: |:....|:.|||:.|                        
plant     6 EPMAPNPKKIDES----NKELKELE-SVHVKHKKRQEMLRN------------------------ 41

  Fly   869 LEQAIKEQKDKLRDQNKEMRNQLVK--KEKMLKENQEIEL--EVKKKENEQKKIS------SDAK 923
                 :|..||.|   |...|.|.:  |::..:..:|::|  |.:||..::|.:|      .|.|
plant    42 -----RELSDKGR---KSCSNHLYESMKQRSSESGKEVKLGCEEQKKHRKKKTMSMSEKRHHDEK 98

  Fly   924 EAKKRMEALEAKYPWIPEEKNCFGMKN---TRYDYSKEDPHEAGNKLAKMQEKKDKMERTLNMNA 985
            :.::.:|...:...|......|.|..:   |.:.....|...|..|...:...|...:|.|:.|.
plant    99 DPRRSLEVAGSSDGWNKTNITCCGFGSGVITGFGLEPPDGLRAQMKNVFLVACKQPDKRLLSSNQ 163

  Fly   986 IMVLDREEENFKETERRRNIVAMDKEKIKKIIVKMD 1021
            ::             |:|.:..:..||.::::|.:|
plant   164 LI-------------RQRALHMVGTEKFEELVVTLD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC2NP_610995.1 Smc 1..1168 CDD:224117 48/231 (21%)
ABC_SMC2_euk 1..>170 CDD:213240
SMC_hinge 520..637 CDD:214944
V_Alix_like 690..933 CDD:187408 31/138 (22%)
P-loop_NTPase <1073..1167 CDD:304359
AT3G28925NP_683601.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.