DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC2 and EMC10

DIOPT Version :9

Sequence 1:NP_610995.1 Gene:SMC2 / 36653 FlyBaseID:FBgn0027783 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_730662.2 Gene:EMC10 / 40396 FlyBaseID:FBgn0052441 Length:227 Species:Drosophila melanogaster


Alignment Length:196 Identity:38/196 - (19%)
Similarity:80/196 - (40%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ICFVLGISNLQNVRAS------------ALQDLVYKNGQAGITKATVTIVFDNTNPAQCPQGYEK 97
            :.||||:     |.:|            .||..:..|.::...:..|||...|:..|...|....
  Fly     9 LIFVLGL-----VSSSWGFLEHDSWITVELQHSLAANSESFSFRGNVTIPSLNSGLANVEQPDLS 68

  Fly    98 CREISVTRQVVVGGKNKFL-INGKLVQNKKVQDFFCSIQLNVNNPNFLIMQGKIQQVL--NMKPK 159
            ..::.:.:::.:|  |:|. :...:|.:...:     .|...:|....::|.::..||  :::|.
  Fly    69 TADLDLLKKLALG--NEFYRLKATVVYSNGAK-----AQFITSNKACRLLQAQLNDVLWVSLEPS 126

  Fly   160 EV---LSMVEEAAGTSQYKTKRDATKTLIEKKETKVRETKVLLDEEVLPK------LVKLRQERS 215
            ..   :::.::.|..:...|:.|..|.|    ||:.....::...|:.|.      :.|:.:||.
  Fly   127 GYVTGITVSQDTAPATIECTQEDVNKLL----ETQFSTDVLIRHAELAPVPDTAGFIQKVERERE 187

  Fly   216 A 216
            |
  Fly   188 A 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC2NP_610995.1 Smc 1..1168 CDD:224117 38/196 (19%)
ABC_SMC2_euk 1..>170 CDD:213240 25/142 (18%)
SMC_hinge 520..637 CDD:214944
V_Alix_like 690..933 CDD:187408
P-loop_NTPase <1073..1167 CDD:304359
EMC10NP_730662.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.