DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC2 and C44C10.10

DIOPT Version :9

Sequence 1:NP_610995.1 Gene:SMC2 / 36653 FlyBaseID:FBgn0027783 Length:1179 Species:Drosophila melanogaster
Sequence 2:NP_509954.1 Gene:C44C10.10 / 183458 WormBaseID:WBGene00008090 Length:127 Species:Caenorhabditis elegans


Alignment Length:61 Identity:18/61 - (29%)
Similarity:28/61 - (45%) Gaps:14/61 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKSYGRRTEIEGFDPEFTAITGLNGSGKSNILDSICFVLGISNLQNVRASALQDLVYKNGQ 71
            ::|:|:          .|.|||.||.|||.::.:|    ||.....|..|:.|....:.|:
 Worm    67 YESFGK----------ITTITGPNGCGKSALVRAI----GILTGDEVTESSNQQYAVRFGK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC2NP_610995.1 Smc 1..1168 CDD:224117 18/61 (30%)
ABC_SMC2_euk 1..>170 CDD:213240 18/61 (30%)
SMC_hinge 520..637 CDD:214944
V_Alix_like 690..933 CDD:187408
P-loop_NTPase <1073..1167 CDD:304359
C44C10.10NP_509954.1 AAA_23 54..>117 CDD:379210 18/61 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.