powered by:
Protein Alignment SMC2 and C44C10.10
DIOPT Version :9
Sequence 1: | NP_610995.1 |
Gene: | SMC2 / 36653 |
FlyBaseID: | FBgn0027783 |
Length: | 1179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509954.1 |
Gene: | C44C10.10 / 183458 |
WormBaseID: | WBGene00008090 |
Length: | 127 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 18/61 - (29%) |
Similarity: | 28/61 - (45%) |
Gaps: | 14/61 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 FKSYGRRTEIEGFDPEFTAITGLNGSGKSNILDSICFVLGISNLQNVRASALQDLVYKNGQ 71
::|:|: .|.|||.||.|||.::.:| ||.....|..|:.|....:.|:
Worm 67 YESFGK----------ITTITGPNGCGKSALVRAI----GILTGDEVTESSNQQYAVRFGK 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1196 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.