DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC2 and AgaP_AGAP011346

DIOPT Version :9

Sequence 1:NP_610995.1 Gene:SMC2 / 36653 FlyBaseID:FBgn0027783 Length:1179 Species:Drosophila melanogaster
Sequence 2:XP_309304.3 Gene:AgaP_AGAP011346 / 1270581 VectorBaseID:AGAP011346 Length:228 Species:Anopheles gambiae


Alignment Length:165 Identity:35/165 - (21%)
Similarity:66/165 - (40%) Gaps:51/165 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 TGSLKAAQGTIQ-QDEKKI-RMASKNIEDDERALAKKEADMAKVQGEFESLKEADARDSKAYEDA 376
            ||.:..||..:. ||..|: |:|.:|      .|.:.||.:...:|..:.|     ..|||...|
Mosquito    58 TGLVSVAQEPLSLQDRNKLKRLAQEN------RLYRLEAHVTDSEGVTKFL-----TSSKACALA 111

  Fly   377 QKKL--------------EAVSQGLSTNENGEASTLQEQLIVAKEQFSEAQTTIKTSEIELRHT- 426
            :.:|              .||:|.::.....|.:.|....:...::|:        :::.::|| 
Mosquito   112 KSQLTDVLWVSLDHTGTVTAVTQSVNNGNLNECADLSNSDVDVLDEFN--------TDVYVKHTE 168

  Fly   427 -----------RGVLKQRE----GETQTNDAAYVK 446
                       :.:.::||    |||:.|.:.:.|
Mosquito   169 PAPIPDTASFIQKMEREREARERGETKDNRSFFAK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC2NP_610995.1 Smc 1..1168 CDD:224117 35/165 (21%)
ABC_SMC2_euk 1..>170 CDD:213240
SMC_hinge 520..637 CDD:214944
V_Alix_like 690..933 CDD:187408
P-loop_NTPase <1073..1167 CDD:304359
AgaP_AGAP011346XP_309304.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.