DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10209 and zgc:153990

DIOPT Version :9

Sequence 1:NP_001260982.1 Gene:CG10209 / 36652 FlyBaseID:FBgn0033971 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001070739.1 Gene:zgc:153990 / 768125 ZFINID:ZDB-GENE-061013-144 Length:347 Species:Danio rerio


Alignment Length:407 Identity:74/407 - (18%)
Similarity:121/407 - (29%) Gaps:167/407 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KKEKEWYWEKIQAALNTIGP-KKTIIQWKKCWRDMRLTTRKKL-AELKRCQLSGGSPPPGIELNQ 87
            |:.|   |.:|.|.:|.||. .:.|::..|.|.|::..|::|| |:.....:|.......|||:.
Zfish    55 KRRK---WAEITARVNEIGECDREIMEVIKKWSDLKCDTKRKLAAQQTGTMVSQRLARSNIELSP 116

  Fly    88 EDNDIIDIVGTEYFYEEMNGELKAENFLTGLDYAPEHLCDAILTAAVGHHQHNMQHQKDPQSHAG 152
            .                   |:..|:.|. ||..|....           |.:.....|.|....
Zfish   117 M-------------------EVIVESILE-LDKKPWEAT-----------QRSRSRSHDDQEPVC 150

  Fly   153 QQQQQDH--HTNDGETNDAPGSSNGGSYQGHPVSQLQAHNGSGGGGEHSGGGQSHSGMLQHPAFH 215
            :.::::.  ....|..|.:||  .|....|.|.:.    :|:||..|....|          |..
Zfish   151 EDEEEEDGGFVGMGSVNSSPG--RGMEVGGMPATT----SGAGGPSEMQFDG----------AKP 199

  Fly   216 GGLHPHLLRRQHGSGSLSRESPFEEKLLQFMQDAFPKKSKKRKNRDPDKLFLLSLYEEIKRVPEE 280
            |....|:                               .....|||   ||              
Zfish   200 GDRESHI-------------------------------DSDEDNRD---LF-------------- 216

  Fly   281 IRLDVKSELMQILKKYQKKSPVKAEKPAPSSTSTSSKLSSSSSGSSTVTT-HLSHSMYQLQKKYE 344
                                      |:.|..|.|:..|....|:|..:. |:|.:.....|:  
Zfish   217 --------------------------PSSSMASVSNSYSEEDGGASRGSAGHVSSTATASTKR-- 253

  Fly   345 KGEREPS------PQSQVERVASAGAVAVPIHTSQQLPLFQLQKKYEENSV------------EK 391
                 ||      |.|..|::|....::|             |:::..|::            |.
Zfish   254 -----PSSFPGVEPDSSREQLAHNANLSV-------------QEQHATNALLSTVSRSLELLAES 300

  Fly   392 VHQQQQQQQSEQRKHVE 408
            :||..:.||...|:.::
Zfish   301 MHQLTETQQEFARESLQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10209NP_001260982.1 GT1 3..65 CDD:304916 13/40 (33%)
BESS 261..295 CDD:281011 3/33 (9%)
zgc:153990NP_001070739.1 Myb_DNA-bind_5 19..93 CDD:290584 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23098
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.