DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10209 and Naif1

DIOPT Version :9

Sequence 1:NP_001260982.1 Gene:CG10209 / 36652 FlyBaseID:FBgn0033971 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_919316.1 Gene:Naif1 / 71254 MGIID:1918504 Length:327 Species:Mus musculus


Alignment Length:341 Identity:64/341 - (18%)
Similarity:103/341 - (30%) Gaps:108/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 AFHGGLHPHLLRRQHGSGSLSRESPFEEKLLQFMQDAFPKKSKKRKNRDPDKLFLLSLYEEIKRV 277
            |:||     :|||.:...:..||.|                                   |:|:.
Mouse    47 AWHG-----ILRRVNAVATCRRELP-----------------------------------EVKKK 71

  Fly   278 PEEIRLDVKSELMQILKKYQKKSPVK-AEKPAPSSTSTSS--KLSSSSSGSSTVTTHLSHSMYQL 339
            ..:::.:|:.::.|:      ::.|: .|.|.|:....:.  ...|.|.||.|....:..:..|.
Mouse    72 WSDLKTEVRRKVAQV------RAAVEGGEAPGPTEDDGAGGPGTGSGSGGSGTAIAPVLLTPMQQ 130

  Fly   340 QKKYEKGERE----PSPQSQVERVA--SAGAVAVPIHTSQQLPLFQLQKKYEENSVEKVHQQQQQ 398
            :.....||..    || .:::..||  |....|....|..|:|........||..||        
Mouse   131 RICNLLGEATIISLPS-TTEIHPVALGSTATTAAATVTLTQIPTETTYHTLEEGVVE-------- 186

  Fly   399 QQSEQRKHVEAAQALHAAHQQPPP-----------PPPNEHLHHPQMAHNIMFPLGQLRNEQPTA 452
                           :...:.|||           .||:..:....:...|.....:|..||...
Mouse   187 ---------------YCTAEAPPPLPTEAPVEMIAQPPDTSVKPQALKSRIALNSAKLIQEQRVT 236

  Fly   453 QQHQHGHNPHQQQQQHPHQQQQQGQQHHPPTIFGSTASERPPMSYENVGXVLSRLWEA------- 510
            ..|......|.:||....|..::.|:      ..:.|.||...:.|.....||.|.:.       
Mouse   237 NLHIKEIAQHLEQQNGLLQMIRRSQE------VQACAQERQAQAMEGTQAALSVLIQVLRPMIKD 295

  Fly   511 -----TCGAPRPATVS 521
                 ....|.||..|
Mouse   296 FRRYLQNNTPNPAPAS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10209NP_001260982.1 GT1 3..65 CDD:304916
BESS 261..295 CDD:281011 4/33 (12%)
Naif1NP_919316.1 Required for nuclear localization and apoptosis-inducing activity. /evidence=ECO:0000250 1..70 10/62 (16%)
Myb_DNA-bind_5 8..82 CDD:290584 12/74 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..118 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 301..327 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23098
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.