DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10209 and si:ch211-107p11.3

DIOPT Version :9

Sequence 1:NP_001260982.1 Gene:CG10209 / 36652 FlyBaseID:FBgn0033971 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001373494.1 Gene:si:ch211-107p11.3 / 564100 ZFINID:ZDB-GENE-030131-3607 Length:213 Species:Danio rerio


Alignment Length:159 Identity:36/159 - (22%)
Similarity:57/159 - (35%) Gaps:57/159 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WEKIQAALNT---IGPKKTIIQWKKCWRDMRLTTRKKLAELKRCQLSGGSPPPGIELNQEDNDII 93
            |.||.:.||.   :||::|..|.|..::::..:..|:.|.||:.         |:...:|     
Zfish    45 WRKIASKLNASNPLGPRRTWQQVKTKYKNVVQSANKRKAALKKM---------GLVQTKE----- 95

  Fly    94 DIVGTEYFYEEMNGELKAENFLTGLDYAPEHLCDAILTAAVGHHQHNMQHQKDPQSHAGQQQQQD 158
                 ||..||   |...||.:.|          .|:.:.||      ....||           
Zfish    96 -----EYIDEE---EPPIENNVDG----------PIIESIVG------GCSSDP----------- 125

  Fly   159 HHTNDGETNDAPGSSNGGSYQGHPVSQLQ 187
                 |:..|.||.|:......|.::.:|
Zfish   126 -----GDMPDMPGCSSYVKVIEHGITLIQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10209NP_001260982.1 GT1 3..65 CDD:304916 10/35 (29%)
BESS 261..295 CDD:281011
si:ch211-107p11.3NP_001373494.1 GT1 5..84 CDD:419993 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23098
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.