powered by:
Protein Alignment CG10209 and naif1
DIOPT Version :9
Sequence 1: | NP_001260982.1 |
Gene: | CG10209 / 36652 |
FlyBaseID: | FBgn0033971 |
Length: | 530 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009301982.1 |
Gene: | naif1 / 562755 |
ZFINID: | ZDB-GENE-081104-236 |
Length: | 321 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 10/40 - (25%) |
Similarity: | 23/40 - (57%) |
Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 WEKIQAALNTIGP-KKTIIQWKKCWRDMRLTTRKKLAELK 70
|.:|...:|.:.. ::.:.:.||.|.|::...|:|:|:.:
Zfish 48 WMEILKRVNAVSTCQRELAEVKKKWSDLKTEVRRKVAQAR 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10209 | NP_001260982.1 |
GT1 |
3..65 |
CDD:304916 |
8/33 (24%) |
BESS |
261..295 |
CDD:281011 |
|
naif1 | XP_009301982.1 |
Myb_DNA-bind_5 |
8..82 |
CDD:290584 |
8/33 (24%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170573219 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23098 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.