DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10209 and naif1

DIOPT Version :9

Sequence 1:NP_001260982.1 Gene:CG10209 / 36652 FlyBaseID:FBgn0033971 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_009301982.1 Gene:naif1 / 562755 ZFINID:ZDB-GENE-081104-236 Length:321 Species:Danio rerio


Alignment Length:40 Identity:10/40 - (25%)
Similarity:23/40 - (57%) Gaps:1/40 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WEKIQAALNTIGP-KKTIIQWKKCWRDMRLTTRKKLAELK 70
            |.:|...:|.:.. ::.:.:.||.|.|::...|:|:|:.:
Zfish    48 WMEILKRVNAVSTCQRELAEVKKKWSDLKTEVRRKVAQAR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10209NP_001260982.1 GT1 3..65 CDD:304916 8/33 (24%)
BESS 261..295 CDD:281011
naif1XP_009301982.1 Myb_DNA-bind_5 8..82 CDD:290584 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23098
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.