DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaPi-T and THI73

DIOPT Version :9

Sequence 1:NP_001260981.1 Gene:NaPi-T / 36651 FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_013104.1 Gene:THI73 / 850690 SGDID:S000003994 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:41/214 - (19%)
Similarity:82/214 - (38%) Gaps:61/214 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 AYVF-SIFADYLLRTDKMSRTNVRKLATFI-----------CCGTKGLIVLALAYFG-YNATAAI 375
            ||:| .....||::...:|:.    |.|||           .|.|...:::.....| :.:::|:
Yeast   127 AYIFMEPVVTYLIQKFPISKI----LGTFITVWGIVLACHAACKTYASLMVVRTLLGLFESSSAV 187

  Fly   376 VLVTVATMLHGAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWK 440
            ..:.::.|.:   :....::.:......|    |...::||:..|      |.|.::.....:|:
Yeast   188 GCIAISGMYY---TKSEQSARIGFWATQA----GTGYIVGGLISF------GFLHYHGTAFTSWQ 239

  Fly   441 NVFLLTSLMLTGSGILYVLFSESKLQPWNSGCHQLPDS-----------GLKELQNLGRDQDDEE 494
            .:||:..|:....|:|..|:              |||:           .::.::::..:|...|
Yeast   240 IMFLVVGLVTVAFGVLTFLY--------------LPDNVTNAWFLNKEEKIQVVEHIRANQTGLE 290

  Fly   495 EKKPLKSD------HDKET 507
            .||..|..      |||.|
Yeast   291 TKKFKKQQVKELFLHDKFT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 29/162 (18%)
MFS 76..460 CDD:119392 28/148 (19%)
THI73NP_013104.1 MFS_FEN2_like 77..481 CDD:340885 41/214 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.