DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NaPi-T and dmGlut

DIOPT Version :9

Sequence 1:NP_001260981.1 Gene:NaPi-T / 36651 FlyBaseID:FBgn0016684 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_620115.2 Gene:dmGlut / 47253 FlyBaseID:FBgn0010497 Length:496 Species:Drosophila melanogaster


Alignment Length:478 Identity:149/478 - (31%)
Similarity:248/478 - (51%) Gaps:38/478 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEARTVLWYMTFIGFIVNYMIRINLNITIVDMIAGKGAITSNETHENSTDLAALAEMNERFSLER 68
            :..|.:|..|.|:..:..|.:|:.|:..|..::..|     |.|.::|..:....:::|..|:  
  Fly    17 IPQRVILAIMGFLAILNAYTMRVCLSQAITVLVVKK-----NSTDDDSEAICEPDDIDEGTSV-- 74

  Fly    69 WFLDWANIPYEKNGFHWNEKQQGALLGSFFWAHWTLQIPGGILATKYGTKLVFGWSNGIGVFC-- 131
                       ...|.|:|:.||.:|.||:..:....||||:||.|:|.|    |:.|:|:..  
  Fly    75 -----------GGDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGK----WTLGLGILSTA 124

  Fly   132 --CFLIPIV-----SYWSYTGLIILRVFQGWITGLAWPSMHVLTAKWIPPNERSKFVSAYL-GSS 188
              ..|.|:.     |.|    ||:.||..|...|..:|::.||.|.|:|.|||.|..:..| |..
  Fly   125 VFTMLTPLAINKGDSDW----LIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGGGQ 185

  Fly   189 VGVALFYPIFGYIIDWTRWEWVYYICGIVGTLWFIAWQFLVFDSPAEHPRIADSERKFIEKSLGA 253
            ||..:...:.|..||...||:|:|..|.:|.:||..:.||.:..|..||.|..|||:::.|.:|.
  Fly   186 VGTIMGNLLSGVFIDAYGWEFVFYFFGGLGVVWFAIFMFLCYSDPTSHPFIKPSEREYLVKEIGT 250

  Fly   254 -SIQGSKGPTPWKAIATSRPVWLNVVAQWGGIWGLFTLMTHAPTYFRLIHHWNIRATGFLSGLPH 317
             |......|||||||.|:.|::..|.||.|..||.:.::|..|.|...:..::|:|.|..|.||:
  Fly   251 ISRNEDLPPTPWKAILTNLPMFALVAAQIGHDWGFYIMVTDLPKYMADVLQFSIKANGLYSSLPY 315

  Fly   318 LMRMLFAYVFSIFADYLLRTDKMSRTNVRKLATFICCGTKGLIVLALAYFGYNATAAIVLVTVAT 382
            :|..:.:......||:::|...:|.||.||:.|.:......:.::..:|.|.:....:||.|:..
  Fly   316 VMMWIVSVGSGFVADWMIRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYAGCDRVLVVVLFTICM 380

  Fly   383 MLHGAVSSGPLASMVDLSPNYAGIVLGVSGMIGGMPGFISPFIVGQLTHNNQTIDAWKNVFLLTS 447
            .|.||..:|...|.:|:||||||.::.::..||.:.|.|:|::||.:|.|...:: |:.||.:..
  Fly   381 GLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVGVMTPNASLLE-WRLVFWVAF 444

  Fly   448 LMLTGSGILYVLFSESKLQPWNS 470
            .:|..:.::|.:::..::||:|:
  Fly   445 GVLCFTAVIYCIWASGEVQPFNN 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NaPi-TNP_001260981.1 2A0114euk 1..474 CDD:129972 149/478 (31%)
MFS 76..460 CDD:119392 132/394 (34%)
dmGlutNP_620115.2 2A0114euk 25..463 CDD:129972 144/464 (31%)
MFS 77..458 CDD:119392 132/389 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG2532
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I245
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 1 1.000 - - mtm14983
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11662
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
87.960

Return to query results.
Submit another query.