DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2b and PGM3

DIOPT Version :9

Sequence 1:NP_610992.2 Gene:Pgm2b / 36649 FlyBaseID:FBgn0033969 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001186846.1 Gene:PGM3 / 5238 HGNCID:8907 Length:570 Species:Homo sapiens


Alignment Length:513 Identity:97/513 - (18%)
Similarity:161/513 - (31%) Gaps:196/513 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GIVVTASHNVKEDNGIKVY----------WSNGAQAMAPHD----QRI--------------HDY 205
            |::||||||.:||||:|:.          |...|..:|..:    ||:              ..:
Human    86 GVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAF 150

  Fly   206 MMNNLEPKPSSWETS-LVLDHPLVEDPYRQIYPLFYEALKTLIPPIYLETNECSQLRF-IYTALH 268
            ::...:.:|||.:.| .|:|...|.......|.|       |..|         ||.: :|....
Human   151 VVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL-------LTTP---------QLHYMVYCRNT 199

  Fly   269 GVGY-PFMREAFYQARLKPVIPVVEQKEADPEFPTLVKPNPEEGKEALKLAIKKADAEHCTLVLA 332
            |..| ....|.:||...|..:.:.:|.....:....:|.:...|..||||    .:.||..    
Human   200 GGRYGKATIEGYYQKLSKAFVELTKQASCSGDEYRSLKVDCANGIGALKL----REMEHYF---- 256

  Fly   333 NDPDVDRLAVAELDPRGRWKLFNGNELGALLGWWALENYKTRTPKPAVTNCIMIATLVSSRILAA 397
                ...|:|         :|||....|.|       |:.          |              
Human   257 ----SQGLSV---------QLFNDGSKGKL-------NHL----------C-------------- 277

  Fly   398 MARVEGFIFVEGMPSFPWMAHRALELEKSGRTVLFAFEECFGYMFGMSLPDKDGIGAAMQLASMA 462
                 |..||:.....|    :.:|::.:.|...|.             .|.|.|          
Human   278 -----GADFVKSHQKPP----QGMEIKSNERCCSFD-------------GDADRI---------- 310

  Fly   463 CYLRSTRNVTLIEKLREIYDTYGYHSSISSVYMADSPETITSVFDHLRNFTDEEGYPKFILDEEF 527
                                .|.||.:....::.|..:..|.:...|:....|.|          
Human   311 --------------------VYYYHDADGHFHLIDGDKIATLISSFLKELLVEIG---------- 345

  Fly   528 EVVHIRDLTIG-LDTSFSDGKA--------RMPV-------------TPDAQLITFTFTNGYVVT 570
                 ..|.|| :.|::::|.:        ::||             ..:..:..:...||:...
Human   346 -----ESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEANGHGTA 405

  Fly   571 LRSAPNDIKIKLNAEICGLPEEKQWEELHDKLNRMTNAVVEEFLQPEENGLTDASTIQ 628
            |.|...::|||.:||        |.|:...|..:|...:::.|.|...:.::|...|:
Human   406 LFSTAVEMKIKQSAE--------QLEDKKRKAAKMLENIIDLFNQAAGDAISDMLVIE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2bNP_610992.2 PTZ00150 26..621 CDD:240294 95/504 (19%)
PGM2 67..607 CDD:100092 93/490 (19%)
PGM3NP_001186846.1 PGM3 50..555 CDD:100088 97/513 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1109
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.