DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2b and pgm3

DIOPT Version :9

Sequence 1:NP_610992.2 Gene:Pgm2b / 36649 FlyBaseID:FBgn0033969 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_021330676.1 Gene:pgm3 / 474321 ZFINID:ZDB-GENE-041024-13 Length:579 Species:Danio rerio


Alignment Length:354 Identity:71/354 - (20%)
Similarity:120/354 - (33%) Gaps:120/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GIVVTASHNVKEDNGIKVY----------WSNGAQAMAPHDQRIHDYMMNNL------------- 210
            |::||||||.:||||:|:.          |...|..:|..:|   |:::..|             
Zfish    93 GVMVTASHNPEEDNGVKLIDPMGEMVAAAWEEYATQLANAEQ---DHLLAALKDIIEKEDISMSE 154

  Fly   211 --------EPKPSSWETSLVL------------DHPLVEDP-------------------YRQIY 236
                    :.:|||...|..:            |:.||..|                   ....|
Zfish   155 AASVYIGRDTRPSSAALSQAVLDGVSSLGGKTHDYGLVSTPQLHYMVCCCNTKGRYGSATLEGYY 219

  Fly   237 PLFYEALKTLIPPIYLETNECSQLRFIYTALHGVGYPFMREAFYQARLKPVIPVVEQKEADPEFP 301
            ....:|...|...:...|::  |.|.:....:|:|...|:|      |:|.|        ..|..
Zfish   220 QKLSQAFLQLTHNVPNRTDD--QKRLLLDGANGIGALKMKE------LEPFI--------RSELQ 268

  Fly   302 TLVKPNPEEGK-------EALKL------AIKKADAEHCTLVLANDPDVDRLAVAELDPRGRWKL 353
            .::..:...||       :.:|:      .:.....|.|   .:.|.|.||:.....|.:..:.|
Zfish   269 VVLSNDGSSGKLNHLCGADYVKVQQKAPQGVSMGVGERC---CSFDGDADRIVYYYTDSKNCFHL 330

  Fly   354 FNGNELGALLGWWALE-------NYKTRTPKPAVTNCIMIATLVSSRILAAMARVEGFIFVEGMP 411
            .:|:::..|:..:..|       |.:....:.|..|.      .|:|.|..:.:|.......|:.
Zfish   331 LDGDKIATLISTFLKELLTQAGLNLQVAVVQTAYANG------SSTRYLEDVMKVAVCCTKTGVK 389

  Fly   412 SFPWMAHRALE------LEKSGR-TVLFA 433
            .   :.|.|.|      .|.:|. ||||:
Zfish   390 H---LHHAAQEYDIGVYFEANGHGTVLFS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2bNP_610992.2 PTZ00150 26..621 CDD:240294 71/354 (20%)
PGM2 67..607 CDD:100092 71/354 (20%)
pgm3XP_021330676.1 PGM3 57..564 CDD:100088 71/354 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1109
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.