DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2b and Pgm3

DIOPT Version :9

Sequence 1:NP_610992.2 Gene:Pgm2b / 36649 FlyBaseID:FBgn0033969 Length:628 Species:Drosophila melanogaster
Sequence 2:NP_001102242.1 Gene:Pgm3 / 363109 RGDID:1305221 Length:552 Species:Rattus norvegicus


Alignment Length:393 Identity:80/393 - (20%)
Similarity:134/393 - (34%) Gaps:144/393 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 GIVVTASHNVKEDNGIKVY----------WSNGAQAMAPHDQRIHD------------------- 204
            |::||||||.:||||:|:.          |...|..:|..:::  |                   
  Rat    58 GVMVTASHNPEEDNGVKLVDPLGEMLAPSWEEHATRLASAEEQ--DLPKVLAAIVEREAVDPQQT 120

  Fly   205 -YMMNNLEPKPSSWETS-------LVL-----DHPLVEDPYRQIYPLFYEALKTLIPPIYLETNE 256
             :::...:.:|||.:.|       .||     |:.|:..|  |::.:.|                
  Rat   121 AFIVVGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGLLTTP--QLHYMVY---------------- 167

  Fly   257 C--SQLRFIYTALHGVGYPFMREAFYQARLKPVIPVVEQKEADPEFPTLVKPNPEEGKEALKLAI 319
            |  |:.|:....:.|         :.|...:..:.:::|.....:....||.:...|..||||  
  Rat   168 CRNSEGRYGQATIEG---------YCQKLSRAFVELMKQASCSGDGSRWVKVDCANGIGALKL-- 221

  Fly   320 KKADAEH-----CTLVLAN-------------------------------------DPDVDRLAV 342
              .:.||     .:::|.|                                     |.|.||:..
  Rat   222 --KEMEHYFRQGLSVLLFNDGTEGRLNHLCGADFVKSQQKPPQGMAMKPGDRCCSFDGDADRIVY 284

  Fly   343 AELDPRGRWKLFNGNELGALLGWWAL-------ENYKTRTPKPAVTNCIMIATLVSSRILAAMAR 400
            ...|..||:.|.:|:::..|:..:..       ||......:.|..|.      .|:|.|..:.:
  Rat   285 YYCDAAGRFHLIDGDKIATLISSFLKELLLEIGENLNIGVVQTAYANG------SSTRYLEEVMK 343

  Fly   401 VEGFIFVEGMPSFPWMAHRALE------LEKSGR-TVLFA-FEECFGYMFGMSLPDKDGIGAAMQ 457
            |..:....|:..   :.|:|.|      .|.:|. |.||: ..|.........|.|:.| .||..
  Rat   344 VPVYCTKTGVKH---LHHKAQEFDIGVYFEANGHGTALFSEAVEARIKRLAQELEDEKG-RAARM 404

  Fly   458 LAS 460
            |||
  Rat   405 LAS 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2bNP_610992.2 PTZ00150 26..621 CDD:240294 80/393 (20%)
PGM2 67..607 CDD:100092 80/393 (20%)
Pgm3NP_001102242.1 PLN02895 1..523 CDD:215485 80/393 (20%)
PGM3 22..525 CDD:100088 80/393 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1109
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.