DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgm2b and prtfdc1a

DIOPT Version :9

Sequence 1:NP_610992.2 Gene:Pgm2b / 36649 FlyBaseID:FBgn0033969 Length:628 Species:Drosophila melanogaster
Sequence 2:XP_002666638.2 Gene:prtfdc1a / 100334391 ZFINID:ZDB-GENE-120727-16 Length:225 Species:Danio rerio


Alignment Length:175 Identity:35/175 - (20%)
Similarity:58/175 - (33%) Gaps:57/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 GYMFGMSLPDKDGIGAAMQLASMACYLRST--RNVTLIEKLREIYDTYGYHSSISSVY------- 494
            ||.|...|           :.|:....|||  |..|.:|.:|  :.:|....|...::       
Zfish    78 GYKFCSDL-----------VESIKAQSRSTNSRLTTRVEFIR--FKSYLNDQSTEDLHIIGPDDL 129

  Fly   495 -------------MADSPETITSVFDHLRNFTDEEGYPKFILDEEFEVVHIRDLTIGLDTSFSDG 546
                         :.|:.:|:.::..|:..|     .||        :|.:..|.:   .....|
Zfish   130 SMLKGKNVLIVEAIVDTGKTMRALLQHVETF-----QPK--------MVKVAGLLV---KRVPHG 178

  Fly   547 KARMPVTPDAQLITFTFTNGYVVTLRSAPNDIKIKLNAEICGLPE 591
            .|.:|     ..:.|...|.:||......|:....|| .||.:.|
Zfish   179 AAELP-----DYVGFVIPNRFVVGYALDYNEYFRDLN-HICVISE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgm2bNP_610992.2 PTZ00150 26..621 CDD:240294 35/175 (20%)
PGM2 67..607 CDD:100092 35/175 (20%)
prtfdc1aXP_002666638.2 PRTases_typeI 10..224 CDD:294217 35/175 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.