DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spred and evlb

DIOPT Version :9

Sequence 1:NP_001260979.1 Gene:Spred / 36643 FlyBaseID:FBgn0020767 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_021324059.1 Gene:evlb / 402929 ZFINID:ZDB-GENE-040426-1804 Length:403 Species:Danio rerio


Alignment Length:347 Identity:80/347 - (23%)
Similarity:136/347 - (39%) Gaps:87/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RAQVMTRDESTEGWLPLAGG--GLANVSIRKRARLSPLASGHDYIIYGQRISDQSVILSCVINRD 76
            ||.||..|::::.|:|:..|  |.:.::|...      .:.:.:.:.|.::.||.|:::..|.:.
Zfish    36 RASVMVYDDTSKKWVPIKPGQQGFSRINIYHN------TTSNTFRVVGVKLQDQQVVINYSIVKG 94

  Fly    77 LKYYKVMPTFHHWRAGKQRNGLTFQTAADARAFDKGVLRAYNEL--------IDGLAKSNPTIIC 133
            |||.:..||||.||..:|..||.|.:..:|..|...:|.|.|.|        :...|::.|:   
Zfish    95 LKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNVLSSQDGGPAVQRQAQNGPS--- 156

  Fly   134 PPLTKYDSVGEDDVFMTLDLPVESESLQ----KIH------SSPEGSE-KSHKSVSNNSDSEKLP 187
                            |.:|.|:...::    :.|      ||..||. :.|.:|.:.:....:|
Zfish   157 ----------------TEELEVQRRQMEMQQMQAHIERERRSSNSGSPFQGHPAVLSVAPPSVVP 205

  Fly   188 PPPIHYIST-DKTSATTSPPDAPPASAA------PSPATAGQIAASENYSYVTLTAVHHDYNYP- 244
            ||    :|. ........||..||..:|      |.|...|        .|....:...|.:.| 
Zfish   206 PP----LSLGGPCPPPPPPPPVPPLPSAGAPPPPPPPLPVG--------GYGAHGSAQDDSSAPT 258

  Fly   245 -VVDQPVGAQVLNARR-ESISALKKRNALEAAQAMAAAQTAAGGGLACRDGGSGKPLHKPNVSDI 307
             :.....||::...:| |..||...:|        .|.:|:         ||||..:.:.|.  :
Zfish   259 GLAAMIAGAKLRRVQRPEDNSASGAKN--------DANRTS---------GGSGGLMEEMNA--L 304

  Fly   308 LKKETRLRCRYCHELYSEDFNR 329
            |.:..:.......|..::|.||
Zfish   305 LARRRKAADEKKDESQNDDLNR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpredNP_001260979.1 EVH1_SPRED-like 9..122 CDD:269978 34/117 (29%)
Sprouty 315..413 CDD:282994 4/15 (27%)
evlbXP_021324059.1 EVH1_Ena_VASP-like 31..139 CDD:269918 33/108 (31%)
VASP_tetra 366..400 CDD:312347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.