DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spred and Vasp

DIOPT Version :9

Sequence 1:NP_001260979.1 Gene:Spred / 36643 FlyBaseID:FBgn0020767 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_038937655.1 Gene:Vasp / 361517 RGDID:1311542 Length:378 Species:Rattus norvegicus


Alignment Length:322 Identity:78/322 - (24%)
Similarity:129/322 - (40%) Gaps:59/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RAQVMTRDESTEGWLPLAGGGLANVSIRKRARLSPLASGHDYIIYGQRIS-DQSVILSCVINRDL 77
            ||.||..|:|.:.||| ||.|....|   |.::....:.:.:.:.|:::. ||.|:::|.|.|.:
  Rat    12 RATVMLYDDSNKRWLP-AGTGPQAFS---RVQIYHNPTANSFRVVGRKLQPDQQVVINCAIIRGV 72

  Fly    78 KYYKVMPTFHHWRAGKQRNGLTFQTAADARAFDKGVLRAYNELIDGLAKSNPTIICPPLTKYDSV 142
            ||.:..|.||.||..:|..||.|.:..||..|..|:..|...|..|   ..|....||       
  Rat    73 KYNQATPIFHQWRDARQVWGLNFGSKEDAAQFAIGMANALEALEGG---GPPPAPAPP------- 127

  Fly   143 GEDDVFMTLDLPVESESLQKIHSSPEGSEKSHKSVSNNSDSEKLP---------------PPPIH 192
                .:.|.:.| ..|.|::....||..|   :.|||.......|               |||..
  Rat   128 ----AWSTQNGP-SPEELEQQKRQPEHLE---RRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPP 184

  Fly   193 YISTDKTSAT-----TSPPDAPPASAAPSPATAGQ----IAASENYSYVTLTAVHHDYNYPVVDQ 248
            .:.....|..     .:||.|||...|..|::.|.    :||:...:.:...:...:.:    ..
  Rat   185 GLPPSGVSGAGHGTGVAPPPAPPLPTAQGPSSGGSGAPGLAAAIAGAKLRKVSKQEEAS----GG 245

  Fly   249 PVGAQVLNAR------RESISAL--KKRNALEAAQAMAAAQTAAGGGLACRDGGSGKPLHKP 302
            |:..:..|:|      .|.::|:  ::|.|.:..:.....::|:......|.....:|:.:|
  Rat   246 PLAPKAENSRGTGGGLMEEMNAMLARRRKATQVGEKPPKDESASQEESEARIPAQSEPVRRP 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpredNP_001260979.1 EVH1_SPRED-like 9..122 CDD:269978 38/108 (35%)
Sprouty 315..413 CDD:282994
VaspXP_038937655.1 EVH1_Ena_VASP-like 7..115 CDD:269918 37/106 (35%)
WH2_hVASP-like 217..243 CDD:409225 3/25 (12%)
VASP_tetra 342..375 CDD:400912
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.