| Sequence 1: | NP_001260979.1 | Gene: | Spred / 36643 | FlyBaseID: | FBgn0020767 | Length: | 519 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_030102994.1 | Gene: | Enah / 13800 | MGIID: | 108360 | Length: | 860 | Species: | Mus musculus |
| Alignment Length: | 381 | Identity: | 83/381 - (21%) |
|---|---|---|---|
| Similarity: | 125/381 - (32%) | Gaps: | 164/381 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 RAQVMTRDESTEGWLPLAGG--GLANVSIRKRARLSPLASGHDYIIYGQRISDQSVILSCVINRD 76
Fly 77 LKYYKVMPTFHHWRAGKQRNGLTFQTAADARAFDKGVLRAYNELIDG--LAKSNPT--------- 130
Fly 131 -IIC-----PPLTKYDSVGEDDVFMTLDLP----------------------------------- 154
Fly 155 ------------VESESLQKIHSSPEGSEKSH--------------------------------- 174
Fly 175 ----KSVSN---NSDSE----KLP----------PPPIH--YISTDKTSATTSPPD------APP 210
Fly 211 ASAAPSPA---TAGQIAASENYSYVTLTAVHHDY--NYPVVDQPVGAQVLNARRES 261 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Spred | NP_001260979.1 | EVH1_SPRED-like | 9..122 | CDD:269978 | 36/109 (33%) |
| Sprouty | 315..413 | CDD:282994 | |||
| Enah | XP_030102994.1 | EVH1_Ena_VASP-like | 36..143 | CDD:269918 | 36/109 (33%) |
| PHA03247 | <356..576 | CDD:223021 | 11/45 (24%) | ||
| VASP_tetra | 823..857 | CDD:370114 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167832310 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4590 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||