DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12857 and CG8260

DIOPT Version :9

Sequence 1:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_573069.1 Gene:CG8260 / 32521 FlyBaseID:FBgn0030684 Length:415 Species:Drosophila melanogaster


Alignment Length:440 Identity:103/440 - (23%)
Similarity:181/440 - (41%) Gaps:84/440 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VLFTNPKL-SAEKLSSNDEINSIARFVSKAEDLEMHRVFSKISKNGVEETTSLNRSLFEFGHNFE 84
            :||..|.| :..||     |||...:|.          |..:...  |....|.::...|.::..
  Fly    15 ILFLTPNLCNLSKL-----INSQCPYVH----------FINVRTR--ERLCYLEQTFLNFANSIR 62

  Fly    85 DADGWLKLEQPCKDRLATVLRYM-FESHLKTTVQ--------IEINNMYFNCHFIVLQVYSRFFS 140
            .    || |.|.:..:..:...: .|.:|...:|        :.:::..|.||.|:|.:|||   
  Fly    63 T----LK-EDPTESEIVEIDHEVPPEEYLVPYIQNYECADIIVTVHDRVFLCHNIILSIYSR--- 119

  Fly   141 ELEMIPLL------VTLPEKIVSQKAFMLSYKWMLSDEPVLELAHIVEVYVAATYLRISGLAAHC 199
              .|:.:|      :......:|.|.|..:|.||:|.:..:....:.|:..||.:|.|..|...|
  Fly   120 --RMLKILQEDVDHIVFKSNDLSPKGFSDAYLWMISSDGEVNPCDMGEILRAAYFLDIPELLEAC 182

  Fly   200 WKYFDDEEYYNEDTACVLYVESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPTSHLIFLLE 264
            |...|...:: |.:|..|..|.:....:..|.:.:..||...:|...:||:||.|..:.:.::|:
  Fly   183 WANLDRITFF-EISAFRLLFELRGATNLWDVFDKLTGRISISILPVASTREFLCLSETQICYILK 246

  Fly   265 SDQICVNTEIEVFFIAVRWLGHDWNKRKVHVRRLMSCIRFNLMPLWYLLYARREEDH------PL 323
            |:.:.:|:|:|...|::         |:....|::|.|||:.:|...|...|.||.|      .:
  Fly   247 SNFLAINSEMEASSISI---------RRSSTYRVLSQIRFSFLPPLMLKKFRSEELHKMPEFSDI 302

  Fly   324 VMKLIFNPEVEYKIDESISR----ITSRMYEDALEGNDAQSEEYASDSGQRNWICDSLCSYYHGV 384
            :.:...:|:|...:.:|:..    :|.|.....|:.:...:|....:  .|:|:.|..|.|:..|
  Fly   303 LKEFSKSPDVITLLRDSVFNSSLLLTVRNNPSVLDTHVEFTEVELME--PRHWVQDHTCDYHRKV 365

  Fly   385 G--CPNTREIRFKHFEDYLS------ELQQCSK-----------DHWSQV 415
            .  |||.|.|....:::||.      |...|.|           |.|..:
  Fly   366 TQLCPNMRFITLNEYQEYLKRLSIGPEFNTCFKHTRDRESEGQEDMWKHM 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12857NP_610987.1 BTB 104..199 CDD:295341 26/109 (24%)
BACK 215..313 CDD:197943 24/97 (25%)
DUF4734 327..415 CDD:292506 25/110 (23%)
CG8260NP_573069.1 BTB 91..182 CDD:295341 24/95 (25%)
BTB 97..190 CDD:197585 26/97 (27%)
BACK 200..287 CDD:197943 24/95 (25%)
DUF4734 308..387 CDD:292506 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.