DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12857 and CG10801

DIOPT Version :9

Sequence 1:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster
Sequence 2:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster


Alignment Length:383 Identity:96/383 - (25%)
Similarity:171/383 - (44%) Gaps:74/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KLEQPCKDR-LATVLRYMFESHL--KTT-------VQIEINNMYFNCHFIVLQVYSRFFSELEMI 145
            ||::.|.:. |:...|.|..:.:  |.|       ::|:|.:.:|....|:...::|.|.::.  
  Fly   172 KLDESCAENILSRCTRRMNNNEIMWKATKMCWFDDLEIQIESRFFFVSHILFTYFARNFRKIS-- 234

  Fly   146 PLLVTLPEKIVSQKAFMLSYKWMLSDEPVLELA-HIVEVYVAATYLRISGLAAHCWKYFDDEEYY 209
            ...:.:|.:.:.....:..|:|||::|....:. :::..|.||.:|.:..|....|..|..:..|
  Fly   235 SQFLQMPVQKIDMAVLIRIYEWMLNEEKTFVVGQNLISFYAAAHWLGVHQLIKQAWSTFSADGVY 299

  Fly   210 N--EDTACVLYVESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPTSHLIFLLESDQICVNT 272
            :  |..|...|:.:||....::: .:|.:|:||..|..||:.:||:...:.:..|||.|.:|||:
  Fly   300 DIWEINAFQAYIMAKDYRCPEIM-IVMQSRLRKCFLPIVASWEFLEFDVNEVTTLLEQDMLCVNS 363

  Fly   273 EIEVFFIAVRWLGHDWNKRKVHVRRLMSCIRFNLMPLWYLLYARR------EEDH-------PLV 324
            |.|:||....||.:.|.:||.|..::|..:||.|:..|    .||      |.|.       |.:
  Fly   364 EDEIFFAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPW----LRRSICNMPENDRIGEIGQLPEI 424

  Fly   325 MKLIFN-----------PEVEYKIDESISRITSRMYEDALEGNDAQSEEYASDSGQRNWI-CDSL 377
            ..||:.           .:.||:    .||:..||..|.         |:...: :|:|: |:.:
  Fly   425 CSLIWEGTLLCQAIIAIGQPEYR----RSRLVRRMLRDF---------EHKRIT-ERSWVFCEGV 475

  Fly   378 CSYYHGVGCPNTREIRFKHFEDYLSELQQCSKDHWSQVIFQDPSKKID--------CC 427
             .::|...|...||:.|:.|:.:|..|      |.:..||.:..|.:.        ||
  Fly   476 -PHHHDKKCARYRELTFESFKRFLHRL------HTNSDIFMESLKAVPNKITNTYRCC 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12857NP_610987.1 BTB 104..199 CDD:295341 21/104 (20%)
BACK 215..313 CDD:197943 34/97 (35%)
DUF4734 327..415 CDD:292506 22/99 (22%)
CG10801NP_570058.1 BACK 306..401 CDD:285009 34/95 (36%)
DUF4734 418..512 CDD:292506 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469515
Domainoid 1 1.000 65 1.000 Domainoid score I17071
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.