DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12857 and LOC1281663

DIOPT Version :10

Sequence 1:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_061497908.1 Gene:LOC1281663 / 1281663 VectorBaseID:AGAMI1_004119 Length:675 Species:Anopheles gambiae


Alignment Length:118 Identity:28/118 - (23%)
Similarity:44/118 - (37%) Gaps:22/118 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TSGYAMLDRRVGLSYEHCIAVMKELAKLHAVSLAMKHAH--PHEYADVCSKIREIVYCPEAAEFY 223
            |...:.|:.:..:.|.||:...:|..:.|     :.|:|  |.::..|........:.|:.....
Mosquito   392 TVAASALEYQYQVMYAHCVQKEREREREH-----LPHSHPLPRQHRAVLVATTPYPHLPQYPTPP 451

  Fly   224 THSLESSLR--------------GA-LDSLRYSNGEQGELDGPIRAVEGLTGR 261
            |.:..|:.|              || |.||.|:..|..||..|.|.|.....|
Mosquito   452 TLNSSSAFRPWGPDTTKAFLHAYGATLSSLPYACQEPPELQNPERVVRSTDKR 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12857NP_610987.1 BTB_POZ 116..190 CDD:453885 6/28 (21%)
BACK 215..313 CDD:197943 17/62 (27%)
DUF4734 326..415 CDD:434992
LOC1281663XP_061497908.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.