DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs31 and trappc5

DIOPT Version :9

Sequence 1:NP_610986.1 Gene:Trs31 / 36641 FlyBaseID:FBgn0266723 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001039139.1 Gene:trappc5 / 733964 XenbaseID:XB-GENE-5734090 Length:188 Species:Xenopus tropicalis


Alignment Length:180 Identity:115/180 - (63%)
Similarity:147/180 - (81%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRVFTVPELQTRLHDLGQDVGTRIIDLYFV 77
            |.:|:||:|.|::.|||||.|..||||||||||.|:||::|.|||.:|.:|||.||.||:|...:
 Frog     7 RGKSSILERSLARPKTEVSLSAFALLFSEIVQYCQNRVYSVSELQAKLSELGQQVGCRILDPLVM 71

  Fly    78 RERSSKRETKLTQMLLFVKTTVWKNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKGS 142
            ||::.|||||:...|||:|...||.||||||:|||.||||::|||||||:||:|.:|||||:..:
 Frog    72 REKNGKRETKVISALLFIKVVAWKALFGKEADKLEQANDDDKTYYIIEKDPLINAYISVPKENST 136

  Fly   143 LNCANFTAGIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQME 192
            ||||:|||||||::||..|||.|||||||||||.|:||::.||||||.::
 Frog   137 LNCASFTAGIVESLLTCSGFPAKVTAHWHKGTTLMIKFDESVIARDKALD 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs31NP_610986.1 TRAPPC5_Trs31 30..181 CDD:271346 99/150 (66%)
trappc5NP_001039139.1 TRAPPC5_Trs31 24..175 CDD:271346 99/150 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 208 1.000 Domainoid score I2808
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5754
Inparanoid 1 1.050 241 1.000 Inparanoid score I3254
OMA 1 1.010 - - QHG53600
OrthoDB 1 1.010 - - D1279541at2759
OrthoFinder 1 1.000 - - FOG0004179
OrthoInspector 1 1.000 - - oto103958
Panther 1 1.100 - - LDO PTHR20902
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1556
SonicParanoid 1 1.000 - - X2928
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.