DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs31 and Trappc5

DIOPT Version :9

Sequence 1:NP_610986.1 Gene:Trs31 / 36641 FlyBaseID:FBgn0266723 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_079977.3 Gene:Trappc5 / 66682 MGIID:1913932 Length:188 Species:Mus musculus


Alignment Length:180 Identity:117/180 - (65%)
Similarity:145/180 - (80%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RPRSNILDRPLSKGKTEVSQSIVALLFSEIVQYSQSRVFTVPELQTRLHDLGQDVGTRIIDLYFV 77
            |.:|.:|:|.|.:.:||||.|..||||||:||:.|||||:|.|||.||..||:.||.|::|....
Mouse     7 RGKSALLERALVRPRTEVSLSAFALLFSELVQHCQSRVFSVAELQARLAALGRQVGARVLDALVA 71

  Fly    78 RERSSKRETKLTQMLLFVKTTVWKNLFGKEAEKLEHANDDERTYYIIEKEPLVNTFISVPKDKGS 142
            ||:.::||||:...|||||..|||.||||||:|||.||||.||:||||:|||:||:|||||:..:
Mouse    72 REKGARRETKVLGALLFVKGAVWKALFGKEADKLEQANDDARTFYIIEREPLINTYISVPKENST 136

  Fly   143 LNCANFTAGIVEAVLTNCGFPCKVTAHWHKGTTYMVKFEDFVIARDKQME 192
            ||||:|||||||||||:.|||.|||||||||||.|:|||:.|||||:.:|
Mouse   137 LNCASFTAGIVEAVLTHSGFPAKVTAHWHKGTTLMIKFEEAVIARDRALE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs31NP_610986.1 TRAPPC5_Trs31 30..181 CDD:271346 102/150 (68%)
Trappc5NP_079977.3 TRAPPC5_Trs31 24..175 CDD:271346 102/150 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850380
Domainoid 1 1.000 209 1.000 Domainoid score I2836
eggNOG 1 0.900 - - E1_COG5128
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5754
Inparanoid 1 1.050 239 1.000 Inparanoid score I3349
Isobase 1 0.950 - 0 Normalized mean entropy S869
OMA 1 1.010 - - QHG53600
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004179
OrthoInspector 1 1.000 - - oto93737
orthoMCL 1 0.900 - - OOG6_102532
Panther 1 1.100 - - LDO PTHR20902
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1556
SonicParanoid 1 1.000 - - X2928
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.